KEGG   Metallosphaera sedula: Msed_1851Help
Entry
Msed_1851         CDS       T00509                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mse  Metallosphaera sedula
Pathway
mse00521  Streptomycin biosynthesis
mse00523  Polyketide sugar unit biosynthesis
mse01130  Biosynthesis of antibiotics
Module
mse_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:mse00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Msed_1851
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Msed_1851
Enzymes [BR:mse01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Msed_1851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom Cupin_1 ARD
Motif
Other DBs
NCBI-ProteinID: ABP95991
UniProt: A4YHT9
Position
1798020..1798550
Genome map
AA seq 176 aa AA seqDB search
MFKFTPILGPVTLIETTQYPDDRGFFQELFRESQFPCRFVQVNHSFSRRGVLRGLHFQAM
PVPQGKLVTVITGRIYDVAVDLRRGFKGWAGVELTPGKLLWIPPGFAHGFQALEDSHVIY
FVTREFSPQHDAGVAWDDPEIGVRWPLPNPILSEKDRKLPRLAESRANFPEDPGTC
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagttcacccccatccttggacctgttaccctaatcgagacaacccaataccct
gacgaccgcgggttctttcaggagcttttcagggagtcgcaattcccctgcaggttcgtt
caggtgaatcattccttctcgaggcgaggggttcttcgcgggcttcactttcaggccatg
ccggtcccacaggggaagctggtcacggtgatcacgggaaggatttacgacgtcgcagtt
gacctcagacgcggtttcaagggatgggctggcgtcgagttaacccctgggaagctactc
tggataccgcctggattcgcccacgggtttcaggcgcttgaggactcacatgtgatctac
ttcgtgacgagggagttctcgccacagcacgacgcgggggttgcgtgggatgaccctgag
ataggcgtgaggtggccccttcctaaccccatcctgtcggagaaggacaggaagctaccg
aggttggctgagtcgagggctaactttcccgaagatcctgggacctgttga

DBGET integrated database retrieval system