KEGG   Metallosphaera sedula: Msed_2088Help
Entry
Msed_2088         CDS       T00509                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mse  Metallosphaera sedula
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mse00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Msed_2088
Enzymes [BR:mse01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Msed_2088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2007128..2008930)
Genome map
AA seq 600 aa AA seqDB search
MRSFPFSAIVGQERLKKALLLVAVDPTITGVLIKGPKGVAKSTAVRALANLLPEIEVVAD
CPFSCDPDHRERMCNGCRARVDQGQRLPRARRRMRIVELPVSATLDRVVGTLDIKRVLKE
GERGLEPGLLALANRGILYIDEVNLLPDEVVNAILDAAASKFNVVEREGISIIHPADFIL
IGTMNPEEGELRPQLLDRFAISVEAESPGSPEELIEISKRVEEFERNPEEFLSKYQEEEA
QLREKILKAKEILPTVKIPDKLMQYLAEEILSQSSSTRAMIAAVKVAKALAALSGKTEVD
EEEAKQALEFVLHHRVSERRASARSSSLPRNQGEVQGNTTSDTNSSGGSRQEKQEQEINL
SIKPDLPKTKSPGTGFGKGGIFDTITGRFRGGGIHLDLHSSLINMALDRRNWLNPDDLVM
KSLETQGAIPILLLLDSSRSMDFSRRILVAKAILRELLQKAYQVRSKVGLVTFSGSEARY
DVPLTRNLRKVEEFVNGVRPAGKTPMSMALYLALQIVNRERRSRRKLNPLVFLISDGKAN
VSLGGNILQELEYFSIKLGEVSKFIVIDTGSPYQPSFNPTLAERAHGLLLRGSDFVDNLH
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
gtgaggtcttttcccttcagtgccattgtgggtcaagagagattaaagaaagcccttctc
ctcgttgcagttgatccaaccatcacaggtgtgctaatcaagggacccaagggagtagcc
aagtccacggctgtaagggctctggccaacctcttgccagagatagaggtggtagctgat
tgccccttttcctgcgatccagaccatagggaaaggatgtgcaacgggtgcagggcgagg
gtagatcaaggccagagacttcccagggctaggagaagaatgaggatagtcgagttacct
gtgagtgccaccctcgacagggttgtgggcaccctcgacataaagagggtcctaaaggaa
ggggaaaggggtcttgaaccaggtctattggccctcgcgaacagggggattctatacata
gacgaagtgaacttacttcccgacgaggtggtgaacgcaattctagatgccgcggcctct
aagtttaacgtggtggagagagaaggcatctccatcattcatcctgcagatttcatcctg
atcgggaccatgaacccggaagagggagaattaaggccacagctactggatagatttgcc
atatccgtggaggcagagtcccctgggagccctgaggagctcatagagatctcaaagcga
gttgaggaatttgagagaaatccagaggagtttctctctaagtaccaagaagaggaagcc
caactcagggagaaaatccttaaggcaaaggagatcttgcccacagttaaaattcccgat
aagctgatgcaatatctggcagaggagattctgtctcaatcctccagtaccagggcaatg
atagcagcggtaaaggtagcaaaggccctcgcagccctaagtggtaagacggaggtggat
gaggaggaagcgaagcaagccctggaattcgtgttacatcacagggtaagcgagaggcgt
gcctcagctcgctccagtagtctccccaggaatcaaggagaggttcaaggcaacactacg
agtgacaccaattcctcaggtggcagtaggcaggaaaaacaggaacaagaaattaacctc
tcaataaagccagatttacccaagacgaagtcacctggaactggcttcggaaaaggtgga
atattcgataccatcaccggcaggtttaggggtggcgggattcatctggatcttcactcc
tccctgattaacatggccctagatcgaaggaactggcttaacccagatgacctagtcatg
aagagcctggagacccagggagcgatacccatcctacttctcctggactctagcaggtcc
atggacttttccaggcgaattctagtcgcaaaggccatacttagggagttgctccagaag
gcataccaagtgaggagcaaggttggtctcgtaactttctcaggatcggaggccagatat
gacgttcccctaaccagaaacttgagaaaagtcgaggagttcgtcaacggggttcgtcct
gctggtaagacccccatgtccatggccctgtacctagccttgcaaatcgtgaacagggag
aggagatccagaagaaagctaaatcccctagtcttcttgatctcggatggtaaggccaac
gtctcccttggaggaaatattctccaagagctagagtatttttctatcaagttaggtgaa
gtttctaagttcatcgtgatagacaccggaagtccctatcagccctctttcaatcccacg
cttgctgagagagctcatggcctcttattacgtggatcagattttgtagataatttgcac
tag

DBGET integrated database retrieval system