KEGG   Mycobacterium smegmatis MC2 155: MSMEI_0354Help
Entry
MSMEI_0354        CDS       T02191                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MSMEI_0354
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    MSMEI_0354
Enzymes [BR:msg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MSMEI_0354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
403059..404222
Genome map
AA seq 387 aa AA seqDB search
MASPRLLATFVALSGLLLACSPAAPPDAGPSTGPSGSPDMQPMATTAPLPEAPATCDLAA
LPARDKLAQLLTVGVTDAADARAVVADHHVGGIMIGSWTDLSMLTDGSLGDIAASAAPLP
LAVSVDEEGGRVSRLASLIGSQPSARELARTKTADEVYGIALDRGRKMRDLGVTVDFAPV
VDVTDAAADTVIGDRSFGSDPAVVTEYAGAYARGLRDAGVLPVLKHFPGHGHASGDSHTG
GVTTPPLDVLMGDDLVPYRTLTGQAPVAVMVGHMQVPGLTGSDPASLSPAAYNLLRSGGY
GGPGFGGLVYTDDLSSMGAINQRYGVADAVLRALQAGADNALWITTAEVPAVLDRLEQAL
ASGELNQGAVDASLQRNAAVKGPLRCG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaccgcgtctgctcgcgacgttcgtagcgctgtccggactgttgctggcctgc
tcgccggccgcgccgcccgacgcaggcccctcaactgggccttccggttcgcccgacatg
cagcccatggccaccaccgcgccgcttcccgaggcccccgcgacgtgtgacctcgccgcg
ctgcccgcccgcgacaagctcgcccagttgctcacggtcggcgtgaccgacgccgcagac
gcgcgtgccgtcgtagcggatcaccacgtcggcggcatcatgatcggcagctggacggac
ctgtcgatgctcaccgacgggtctctcggcgacatcgcggcgtcggcggcgccgctgccg
ctcgcggtcagcgtcgacgaagaaggcggccgggtgtcgcggctggcgtcgctgatcggc
agccagccctcggcccgtgagctcgcgcgcaccaagaccgccgacgaggtgtacggcatc
gcgctcgaccgcggccgcaagatgcgcgacctgggtgtcacggtcgacttcgcacccgtc
gtcgacgtcaccgacgccgcggccgacaccgtgatcggggatcgctcgttcggctccgat
cccgcggtcgtcaccgagtacgcaggcgcctacgcgcgtggcctgcgcgacgcgggcgtg
ctgccggtgctcaagcacttcccgggccacggccacgcctcgggtgactcccacaccggt
ggggtcaccacgccgccgctcgatgtcctgatgggtgacgatctcgtgccgtaccgcacg
ctcaccgggcaggcgccggtcgcggtcatggtcggccacatgcaggtaccgggcctgacc
ggttccgatccggcgagcctgagccccgccgcctacaacctgctgcgctcgggtggctac
ggcggcccgggtttcggcggcctggtctacaccgacgatctgtccagcatgggcgccatc
aaccagcgctacggcgtcgccgacgccgtgctgcgggccctgcaggccggcgccgacaac
gcgctgtggatcaccacggccgaggtgcccgcggtgctcgaccggctcgagcaggcgctg
gcgtccggcgagctgaaccagggcgcggtggacgcctcgctgcagcgcaacgccgcggtc
aagggcccgctgcgctgcggctga

DBGET integrated database retrieval system