KEGG   Mycobacterium smegmatis MC2 155: MSMEI_0354Help
Entry
MSMEI_0354        CDS       T02191                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:msg00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:msg00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
403059..404222
Genome map
AA seq 387 aa AA seqDB search
MASPRLLATFVALSGLLLACSPAAPPDAGPSTGPSGSPDMQPMATTAPLPEAPATCDLAA
LPARDKLAQLLTVGVTDAADARAVVADHHVGGIMIGSWTDLSMLTDGSLGDIAASAAPLP
LAVSVDEEGGRVSRLASLIGSQPSARELARTKTADEVYGIALDRGRKMRDLGVTVDFAPV
VDVTDAAADTVIGDRSFGSDPAVVTEYAGAYARGLRDAGVLPVLKHFPGHGHASGDSHTG
GVTTPPLDVLMGDDLVPYRTLTGQAPVAVMVGHMQVPGLTGSDPASLSPAAYNLLRSGGY
GGPGFGGLVYTDDLSSMGAINQRYGVADAVLRALQAGADNALWITTAEVPAVLDRLEQAL
ASGELNQGAVDASLQRNAAVKGPLRCG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaccgcgtctgctcgcgacgttcgtagcgctgtccggactgttgctggcctgc
tcgccggccgcgccgcccgacgcaggcccctcaactgggccttccggttcgcccgacatg
cagcccatggccaccaccgcgccgcttcccgaggcccccgcgacgtgtgacctcgccgcg
ctgcccgcccgcgacaagctcgcccagttgctcacggtcggcgtgaccgacgccgcagac
gcgcgtgccgtcgtagcggatcaccacgtcggcggcatcatgatcggcagctggacggac
ctgtcgatgctcaccgacgggtctctcggcgacatcgcggcgtcggcggcgccgctgccg
ctcgcggtcagcgtcgacgaagaaggcggccgggtgtcgcggctggcgtcgctgatcggc
agccagccctcggcccgtgagctcgcgcgcaccaagaccgccgacgaggtgtacggcatc
gcgctcgaccgcggccgcaagatgcgcgacctgggtgtcacggtcgacttcgcacccgtc
gtcgacgtcaccgacgccgcggccgacaccgtgatcggggatcgctcgttcggctccgat
cccgcggtcgtcaccgagtacgcaggcgcctacgcgcgtggcctgcgcgacgcgggcgtg
ctgccggtgctcaagcacttcccgggccacggccacgcctcgggtgactcccacaccggt
ggggtcaccacgccgccgctcgatgtcctgatgggtgacgatctcgtgccgtaccgcacg
ctcaccgggcaggcgccggtcgcggtcatggtcggccacatgcaggtaccgggcctgacc
ggttccgatccggcgagcctgagccccgccgcctacaacctgctgcgctcgggtggctac
ggcggcccgggtttcggcggcctggtctacaccgacgatctgtccagcatgggcgccatc
aaccagcgctacggcgtcgccgacgccgtgctgcgggccctgcaggccggcgccgacaac
gcgctgtggatcaccacggccgaggtgcccgcggtgctcgaccggctcgagcaggcgctg
gcgtccggcgagctgaaccagggcgcggtggacgcctcgctgcagcgcaacgccgcggtc
aagggcccgctgcgctgcggctga

DBGET integrated database retrieval system