KEGG   Mycobacterium smegmatis MC2 155: MSMEI_0421Help
Entry
MSMEI_0421        CDS       T02191                                 

Definition
uroporphyrinogen III synthase HEM4 (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MSMEI_0421
Enzymes [BR:msg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MSMEI_0421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(509111..510268)
Genome map
AA seq 385 aa AA seqDB search
MREPDWAPLTGFRVAVTSARRADELCALLRRRGATVTSAPAITMVPLPDDDELRAHTESL
ITDPPDIVVATTGIGLRGWIAAADGWGLAGELTEALGKARIVSRGPKATGALRAAGLPEE
WSPDSESSREVVRYLVEHGVDGRRIAVQLHGATDDWDPFPEFLDELRVAGAEVVPIRVYR
WHPAPPGGEFDQLVAGIAERRFDAVSFTSAPAVASVLMRATELGLTEQVVSALRTDVHAM
CVGPVTARPLVRLGIPTSAPERMRLGALARHITDELPLLQSRTLRVAGHLLEIRGTCVLV
DGVVKSLSPAGMATIRALAHRPGAVVSRFDLLGALPGSGTDTHAVETAVLRLRTALGDKS
IVSTVVKRGYRLAVDDTDTEMARAL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgagcccgactgggcacccctcaccggattccgggtggcggtgacctccgcccga
cgagccgatgaactgtgcgccctgctgcgcaggaggggcgcgacggtgaccagcgcgccc
gcgatcaccatggtgccgctgcccgacgacgacgaactgcgggcacacaccgagtcgttg
atcaccgacccgcccgacatcgtcgtcgccaccaccggcatcgggttgcgggggtggatc
gccgcagccgacggctggggcctggccggcgagctgaccgaggcgctgggcaaggctcgc
atcgtgtccagggggccgaaggccacgggggcactgcgggccgccgggttgccggaggag
tggtcgccggactccgaatcctcccgcgaggtggtccgctacctcgtcgagcacggcgtc
gacggccggcgcatcgccgtgcaactccacggcgccaccgacgactgggatccgttccct
gagttcctcgacgagctgcgtgtcgcgggtgcagaggtggtgccgatccgtgtctaccgg
tggcatcccgccccaccgggcggcgagttcgaccaactcgtcgcaggcatcgccgaacgg
cgcttcgacgcagtcagtttcacctcggccccggccgtcgcctcggtgctgatgagagcc
accgagttgggactgaccgagcaggtggtctccgcgctgcgcaccgacgtccacgcgatg
tgcgtcggaccggtcacggcgcgtccgctcgtgcgcctcggcattcccacgtcggcgccc
gagcgcatgcggttgggcgcactggcccgccacatcaccgacgagttgcccctgctgcag
tcccgtacgttgcgggtcgcgggtcacctcctcgagatccgcgggacctgcgtgctggtg
gacggcgtggtcaagtcgctgtcccccgcgggtatggccaccatccgggcgctcgcgcac
cggcccggcgcggtggtgtcacgtttcgatctgctgggcgcgctgcccggcagcgggacc
gacacccacgccgtcgagaccgcggtgctgcgccttcgaactgcattgggagacaagagc
atcgtgtccaccgtggtgaaaaggggttatcggctggcggtcgacgacaccgacacagag
atggcacgcgcgttatga

DBGET integrated database retrieval system