KEGG   Mycobacterium smegmatis MC2 155: MSMEI_0501Help
Entry
MSMEI_0501        CDS       T02191                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MSMEI_0501
  Lipid metabolism
   00561 Glycerolipid metabolism
    MSMEI_0501
   00600 Sphingolipid metabolism
    MSMEI_0501
Enzymes [BR:msg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     MSMEI_0501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
595700..597013
Genome map
AA seq 437 aa AA seqDB search
MKPTVAIIGAGSVEFTRELLGDILSFPELATTRIVLHDINTERLETAEAIARATARAADA
DPEISATTDRRRALDGADYVINVIQVGMHEATVRDFEIPARYGLNQSIGDTIGIGGIFRG
LRTFPVLAGIARDMQEVCPDAWLLNYTNPMAMNVTYLHHIAPRLKVLGLCHSVYWTMVGL
CELIDVPYEEVSYWSAGVNHQAWVLRWERNGQNLYPELDRRIAADAELQRRVRVDMYRRL
GYYPTETSEHSSEYVPWYVHHRQEIDRLRINVGEYVSISKANLAEYARIREELADADSLP
IDTGSTEYAPQVIHSLETGTTRVISANVANQGLITNLPDGLAVEVPTTLDALGAHPMRVG
DLPPQCAALNRNFLGPVDLTVRAAIDGDPRLVRAAAMVDPNTAATLTVDQIWDLCDELTS
AHGDLLPEPLRSAVCNP
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacccaccgttgcgatcatcggcgcgggtagcgtcgagttcacccgggaactgctc
ggcgacatcctgtcgttccccgagctcgccaccacacggatcgtgttgcacgacatcaac
accgagcgtctcgagacagcggaagccatcgcacgggccaccgcccgcgcggcggacgcc
gaccccgagatcagcgcgaccaccgaccgccgccgcgcactcgacggcgccgattacgtc
atcaacgtcatccaggtcggtatgcacgaggccaccgtgcgggacttcgagatccccgcc
cgatacggcctgaaccagagcatcggtgacaccatcggcatcggcggaatcttccgcggc
ctgcggaccttcccggtgctggccggcatcgccagggacatgcaggaggtgtgccccgat
gcctggctgcttaactacaccaacccgatggccatgaacgtcacgtacctgcaccacatc
gcaccgcggctgaaggtgctcggcctgtgccactcggtgtactggaccatggtcggcctg
tgtgaactgatcgacgttccctacgaggaggtctcgtactggtccgccggcgtcaaccac
caggcctgggttctgcgatgggaacgcaacggccagaacctttatccggaactcgaccgg
cgtatcgcggccgacgcagagttgcagcgccgggtacgtgtcgacatgtaccggcgtctc
ggttactacccgacggagaccagcgaacactccagtgagtacgtgccgtggtacgtacac
caccggcaggaaatcgaccggctgcgcatcaacgtcggcgagtacgtgtcgatcagcaag
gccaacctcgccgaatacgccaggatccgggaggaactggccgatgccgactcgctgccc
atcgacaccggctccaccgagtacgccccgcaggtgatccactcgctggaaaccggtacc
accagggtcatctcggccaacgtcgccaaccaggggctcatcaccaaccttcccgacggc
ctggcggtcgaggttccgacgacactcgatgcgctcggcgcgcatcccatgcgggtgggg
gatctgccgccccaatgcgccgcgctcaaccgcaacttcctcggtcccgtcgatctgacc
gtccgcgcggcgatcgacggtgatcctcggctggtccgtgccgcggccatggtcgacccc
aacaccgcggccacgctgaccgtcgaccagatctgggacctgtgcgacgaattgacctcc
gcgcacggggatctgctgcccgaaccgctgcgatccgccgtctgtaacccctga

DBGET integrated database retrieval system