KEGG   Mycobacterium smegmatis MC2 155: MSMEI_0700Help
Entry
MSMEI_0700        CDS       T02191                                 

Definition
(GenBank) Acetyl-CoA synthetase (Acetate-CoA ligase)
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
msg00010  Glycolysis / Gluconeogenesis
msg00620  Pyruvate metabolism
msg00640  Propanoate metabolism
msg00680  Methane metabolism
msg01100  Metabolic pathways
msg01110  Biosynthesis of secondary metabolites
msg01120  Microbial metabolism in diverse environments
msg01130  Biosynthesis of antibiotics
msg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSMEI_0700
   00620 Pyruvate metabolism
    MSMEI_0700
   00640 Propanoate metabolism
    MSMEI_0700
  Energy metabolism
   00680 Methane metabolism
    MSMEI_0700
Enzymes [BR:msg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MSMEI_0700
Lipid biosynthesis proteins [BR:msg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MSMEI_0700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AFP37180
UniProt: I7F6G2
Position
806465..808222
Genome map
AA seq 585 aa AA seqDB search
MVGDARTLVACRVPRRGLPGNGIRPDVHEDSESELLMARDVCTVEQAWDAIESRLDRDPF
GPDFNTAHEACSRYATDPGRLALTVRHEDGSADQWSYRELDRQAAKAARVFARAGLRRGD
RVAGLLTRQVESWITALAAWRSGLVYVPLFGGFGPEPIALRIKAARVSAVVVDARYREAL
HRAQQLGDLDVSVFVVGGSEVACDRSFWSDLDSADADGPIVPTKIVDTATILFTSGTSGT
PKACVMTHAAFLSVMPYAVSVLGLGPHSRDVVFSTADPAWAYGLYSTGASVMALGVHRVM
YTGPFVPEKWYRVLTEEQATVVTTAPAALRRWTEPLTHGGVPSSLRLVAAAGEPLTEAVA
SAWEATGAPPVRNGYGLSEVGMLLGDVLDADVPLHPGKIAGTIPGFDVFLADRDGQPVGE
GEPGLIAVRRPRHQMSAGYENVPERWEARWREDVFLTEDLAVRDAEGRWQVLGRDDDIII
ASGHNVSPVEVENALLQHPGVAEAAAVAHVDDTYGNVVRAVVVRTDTAPAQDVMVDELKG
LVGQHVGRYAAPRVVDFVSELPRTEVGKLRRAALRDNPVSGVSAP
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
gtggtcggcgacgcacggacactggtcgcttgccgcgtacctcgccgcggcctgcctggc
aacggtattcgccctgatgttcacgaagacagcgaaagtgagttactgatggcgcgcgac
gtatgcactgtcgagcaggcctgggacgccatcgagtcgcggctcgaccgtgatcctttc
ggcccggacttcaacaccgcacacgaggcgtgcagccggtatgcgaccgatccgggacgc
ctggcgctgacggtccggcatgaggacggatcggccgaccagtggagctaccgtgagctg
gaccgccaggccgccaaggccgcaagggttttcgcgcgtgcgggcctgcgccgcggcgac
cgcgtggcgggactgctgacgcgtcaggtcgagagttggatcaccgcgttggccgcctgg
cgatccggtctggtgtacgtgccgttgttcggcggcttcggtcccgagccgatcgcgttg
cgtatcaaagccgcccgagtgtcggccgtcgtcgtcgatgcgcggtaccgcgaagcgttg
caccgcgcgcagcaactgggcgacctcgatgtgtccgtgttcgtcgtcggtggctccgag
gtggcgtgcgaccgatccttctggtctgatctggactccgccgatgccgacggtcccatc
gtccccaccaaaatcgttgacaccgcgacgatcctgttcaccagcggaacgtcgggaact
cccaaggcctgcgtgatgacccacgcggcgttcctgtcggtgatgccgtatgccgtcagt
gtgctcggcctcggcccacattcgcgtgatgtggtcttctcgaccgcggatcccgcctgg
gcgtatgggctgtattccaccggtgcgtcggtgatggccctgggcgtgcaccgcgtcatg
tacaccgggcccttcgtgcccgagaagtggtaccgcgtgctgaccgaggagcaggcgacc
gtcgtcacgacggcgccggcggcgctgcgccgctggaccgaaccgctgacacatggcggg
gtgccatcgagtctgcgcctggtggcggcggccggcgaaccactgaccgaagccgtggca
agcgcatgggaggcgactggcgcgcctccggtgcgcaacggttacggcttgtcagaggtc
ggcatgttgctcggcgacgtgctcgatgcggacgtccccctgcacccgggcaagatcgcc
gggaccataccgggtttcgacgtgttcctcgccgaccgggacggacaacccgtgggcgaa
ggcgagccgggcctgatcgccgtacggcgaccacgccaccagatgtcggccggttacgag
aacgtgcccgagcggtgggaggcgcgttggcgcgaagatgttttcctcaccgaggatctc
gcggtccgcgacgccgaggggcggtggcaggtgctcgggcgtgacgacgacatcatcatc
gcctccggtcacaacgtcagccccgtcgaggtggagaacgccctgttgcagcatccgggc
gtcgccgaggccgcggccgtcgcccacgtcgacgacacgtacggcaacgtggtgcgcgcg
gtggtggtacggaccgacaccgcgccggcgcaggacgtcatggtcgacgaattgaagggc
cttgtgggacagcacgtcggccgctacgccgccccgcgggtcgtcgacttcgtgagcgaa
ctgccgcgcaccgaggtgggtaagttgcgtcgtgccgcgctccgggacaatccggtgagc
ggggtcagtgcaccgtga

DBGET integrated database retrieval system