KEGG   Mycobacterium smegmatis MC2 155: MSMEI_0700Help
Entry
MSMEI_0700        CDS       T02191                                 

Definition
acetyl-CoA synthetase (Acetate-CoA ligase) (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MSMEI_0700
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSMEI_0700
   00620 Pyruvate metabolism
    MSMEI_0700
   00640 Propanoate metabolism
    MSMEI_0700
  Energy metabolism
   00680 Methane metabolism
    MSMEI_0700
Enzymes [BR:msg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MSMEI_0700
Lipid biosynthesis proteins [BR:msg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MSMEI_0700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
806465..808222
Genome map
AA seq 585 aa AA seqDB search
MVGDARTLVACRVPRRGLPGNGIRPDVHEDSESELLMARDVCTVEQAWDAIESRLDRDPF
GPDFNTAHEACSRYATDPGRLALTVRHEDGSADQWSYRELDRQAAKAARVFARAGLRRGD
RVAGLLTRQVESWITALAAWRSGLVYVPLFGGFGPEPIALRIKAARVSAVVVDARYREAL
HRAQQLGDLDVSVFVVGGSEVACDRSFWSDLDSADADGPIVPTKIVDTATILFTSGTSGT
PKACVMTHAAFLSVMPYAVSVLGLGPHSRDVVFSTADPAWAYGLYSTGASVMALGVHRVM
YTGPFVPEKWYRVLTEEQATVVTTAPAALRRWTEPLTHGGVPSSLRLVAAAGEPLTEAVA
SAWEATGAPPVRNGYGLSEVGMLLGDVLDADVPLHPGKIAGTIPGFDVFLADRDGQPVGE
GEPGLIAVRRPRHQMSAGYENVPERWEARWREDVFLTEDLAVRDAEGRWQVLGRDDDIII
ASGHNVSPVEVENALLQHPGVAEAAAVAHVDDTYGNVVRAVVVRTDTAPAQDVMVDELKG
LVGQHVGRYAAPRVVDFVSELPRTEVGKLRRAALRDNPVSGVSAP
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
gtggtcggcgacgcacggacactggtcgcttgccgcgtacctcgccgcggcctgcctggc
aacggtattcgccctgatgttcacgaagacagcgaaagtgagttactgatggcgcgcgac
gtatgcactgtcgagcaggcctgggacgccatcgagtcgcggctcgaccgtgatcctttc
ggcccggacttcaacaccgcacacgaggcgtgcagccggtatgcgaccgatccgggacgc
ctggcgctgacggtccggcatgaggacggatcggccgaccagtggagctaccgtgagctg
gaccgccaggccgccaaggccgcaagggttttcgcgcgtgcgggcctgcgccgcggcgac
cgcgtggcgggactgctgacgcgtcaggtcgagagttggatcaccgcgttggccgcctgg
cgatccggtctggtgtacgtgccgttgttcggcggcttcggtcccgagccgatcgcgttg
cgtatcaaagccgcccgagtgtcggccgtcgtcgtcgatgcgcggtaccgcgaagcgttg
caccgcgcgcagcaactgggcgacctcgatgtgtccgtgttcgtcgtcggtggctccgag
gtggcgtgcgaccgatccttctggtctgatctggactccgccgatgccgacggtcccatc
gtccccaccaaaatcgttgacaccgcgacgatcctgttcaccagcggaacgtcgggaact
cccaaggcctgcgtgatgacccacgcggcgttcctgtcggtgatgccgtatgccgtcagt
gtgctcggcctcggcccacattcgcgtgatgtggtcttctcgaccgcggatcccgcctgg
gcgtatgggctgtattccaccggtgcgtcggtgatggccctgggcgtgcaccgcgtcatg
tacaccgggcccttcgtgcccgagaagtggtaccgcgtgctgaccgaggagcaggcgacc
gtcgtcacgacggcgccggcggcgctgcgccgctggaccgaaccgctgacacatggcggg
gtgccatcgagtctgcgcctggtggcggcggccggcgaaccactgaccgaagccgtggca
agcgcatgggaggcgactggcgcgcctccggtgcgcaacggttacggcttgtcagaggtc
ggcatgttgctcggcgacgtgctcgatgcggacgtccccctgcacccgggcaagatcgcc
gggaccataccgggtttcgacgtgttcctcgccgaccgggacggacaacccgtgggcgaa
ggcgagccgggcctgatcgccgtacggcgaccacgccaccagatgtcggccggttacgag
aacgtgcccgagcggtgggaggcgcgttggcgcgaagatgttttcctcaccgaggatctc
gcggtccgcgacgccgaggggcggtggcaggtgctcgggcgtgacgacgacatcatcatc
gcctccggtcacaacgtcagccccgtcgaggtggagaacgccctgttgcagcatccgggc
gtcgccgaggccgcggccgtcgcccacgtcgacgacacgtacggcaacgtggtgcgcgcg
gtggtggtacggaccgacaccgcgccggcgcaggacgtcatggtcgacgaattgaagggc
cttgtgggacagcacgtcggccgctacgccgccccgcgggtcgtcgacttcgtgagcgaa
ctgccgcgcaccgaggtgggtaagttgcgtcgtgccgcgctccgggacaatccggtgagc
ggggtcagtgcaccgtga

DBGET integrated database retrieval system