KEGG   Mycobacterium smegmatis MC2 155: MSMEI_0700Help
Entry
MSMEI_0700        CDS       T02191                                 

Definition
acetyl-CoA synthetase (Acetate-CoA ligase) (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:msg01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:msg00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:msg00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:msg00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:msg00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
806465..808222
Genome map
AA seq 585 aa AA seqDB search
MVGDARTLVACRVPRRGLPGNGIRPDVHEDSESELLMARDVCTVEQAWDAIESRLDRDPF
GPDFNTAHEACSRYATDPGRLALTVRHEDGSADQWSYRELDRQAAKAARVFARAGLRRGD
RVAGLLTRQVESWITALAAWRSGLVYVPLFGGFGPEPIALRIKAARVSAVVVDARYREAL
HRAQQLGDLDVSVFVVGGSEVACDRSFWSDLDSADADGPIVPTKIVDTATILFTSGTSGT
PKACVMTHAAFLSVMPYAVSVLGLGPHSRDVVFSTADPAWAYGLYSTGASVMALGVHRVM
YTGPFVPEKWYRVLTEEQATVVTTAPAALRRWTEPLTHGGVPSSLRLVAAAGEPLTEAVA
SAWEATGAPPVRNGYGLSEVGMLLGDVLDADVPLHPGKIAGTIPGFDVFLADRDGQPVGE
GEPGLIAVRRPRHQMSAGYENVPERWEARWREDVFLTEDLAVRDAEGRWQVLGRDDDIII
ASGHNVSPVEVENALLQHPGVAEAAAVAHVDDTYGNVVRAVVVRTDTAPAQDVMVDELKG
LVGQHVGRYAAPRVVDFVSELPRTEVGKLRRAALRDNPVSGVSAP
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
gtggtcggcgacgcacggacactggtcgcttgccgcgtacctcgccgcggcctgcctggc
aacggtattcgccctgatgttcacgaagacagcgaaagtgagttactgatggcgcgcgac
gtatgcactgtcgagcaggcctgggacgccatcgagtcgcggctcgaccgtgatcctttc
ggcccggacttcaacaccgcacacgaggcgtgcagccggtatgcgaccgatccgggacgc
ctggcgctgacggtccggcatgaggacggatcggccgaccagtggagctaccgtgagctg
gaccgccaggccgccaaggccgcaagggttttcgcgcgtgcgggcctgcgccgcggcgac
cgcgtggcgggactgctgacgcgtcaggtcgagagttggatcaccgcgttggccgcctgg
cgatccggtctggtgtacgtgccgttgttcggcggcttcggtcccgagccgatcgcgttg
cgtatcaaagccgcccgagtgtcggccgtcgtcgtcgatgcgcggtaccgcgaagcgttg
caccgcgcgcagcaactgggcgacctcgatgtgtccgtgttcgtcgtcggtggctccgag
gtggcgtgcgaccgatccttctggtctgatctggactccgccgatgccgacggtcccatc
gtccccaccaaaatcgttgacaccgcgacgatcctgttcaccagcggaacgtcgggaact
cccaaggcctgcgtgatgacccacgcggcgttcctgtcggtgatgccgtatgccgtcagt
gtgctcggcctcggcccacattcgcgtgatgtggtcttctcgaccgcggatcccgcctgg
gcgtatgggctgtattccaccggtgcgtcggtgatggccctgggcgtgcaccgcgtcatg
tacaccgggcccttcgtgcccgagaagtggtaccgcgtgctgaccgaggagcaggcgacc
gtcgtcacgacggcgccggcggcgctgcgccgctggaccgaaccgctgacacatggcggg
gtgccatcgagtctgcgcctggtggcggcggccggcgaaccactgaccgaagccgtggca
agcgcatgggaggcgactggcgcgcctccggtgcgcaacggttacggcttgtcagaggtc
ggcatgttgctcggcgacgtgctcgatgcggacgtccccctgcacccgggcaagatcgcc
gggaccataccgggtttcgacgtgttcctcgccgaccgggacggacaacccgtgggcgaa
ggcgagccgggcctgatcgccgtacggcgaccacgccaccagatgtcggccggttacgag
aacgtgcccgagcggtgggaggcgcgttggcgcgaagatgttttcctcaccgaggatctc
gcggtccgcgacgccgaggggcggtggcaggtgctcgggcgtgacgacgacatcatcatc
gcctccggtcacaacgtcagccccgtcgaggtggagaacgccctgttgcagcatccgggc
gtcgccgaggccgcggccgtcgcccacgtcgacgacacgtacggcaacgtggtgcgcgcg
gtggtggtacggaccgacaccgcgccggcgcaggacgtcatggtcgacgaattgaagggc
cttgtgggacagcacgtcggccgctacgccgccccgcgggtcgtcgacttcgtgagcgaa
ctgccgcgcaccgaggtgggtaagttgcgtcgtgccgcgctccgggacaatccggtgagc
ggggtcagtgcaccgtga

DBGET integrated database retrieval system