KEGG   Mycobacterium smegmatis MC2 155: MSMEI_0929Help
Entry
MSMEI_0929        CDS       T02191                                 

Definition
Uroporphyrin-III C-methyltransferase/uroporphyrinogen-III synthase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MSMEI_0929
Enzymes [BR:msg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     MSMEI_0929
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MSMEI_0929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1032928..1034859
Genome map
AA seq 643 aa AA seqDB search
MTRQVPLGGAESLTAVGGAESLATFGGVESVATMGGADSLTKVGGADAAVAVVGAAEGSV
GAAESPASDPQPRESSSRSRSRKVKPGRITFVGSGPGDPGLLTTRAQAVLAHAELVFTDP
DVPEAVLALVGTDLPPAAGPAPAKKNDKADKATDKSDKSDKADKADDAKSDDPAVIPGGP
EVRPALGDPAEVAKTLASEARHGYNVVRLIAGDPLSVDAVITEINALAKTHLTFEIVPGL
PDTTAVPTYAGLPLGSSHTVADVRGDVDWAALAAAPGPLILHATASHLPDAARTLIEHGL
VENTPAVVTANGTTCQQRSVETTLVGLTDKTVVEKPAGSELLGPLTGPLVVTIGKTVANR
AKLNWWESRALYGWTVLVPRTKDQAGEMSERLVTHGALPIEVPTIAVEPPRSPAQMERAV
KGLVDGRFQWVVFTSTNAVRAVWEKFNEFGLDARAFSGVKIACVGQATADKVRAFGINPE
LVPSGEQSSLGLLDEFPPYDEVFDPVNRVLLPRADIATETLAEGLRERGWEIEDVTAYRT
VRAAPPPAHTREMIKTGGFDAVCFTSSSTVRNLVGIAGKPHARTIVACIGPKTAETAIEF
GLRVDVQPETAAVGPLVEALAEHAARLRAEGALPPPRKKSRRR
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgacccggcaggtccccctcggcggagccgagagtctgactgcagttggcggagccgag
agtctggccaccttcggcggagttgaaagcgtggccaccatgggcggagccgacagtctc
accaaggtgggcggtgccgacgctgcggttgcggtggtcggtgcggccgagggttcggtc
ggtgcggccgagagcccggcgtccgaccctcagccgcgtgagagctcgagccggtcgcgc
agccgcaaggtcaagcccggtcgcatcacgttcgtcggttcgggccccggtgacccgggc
ctgctgaccaccagggcgcaggccgtgctcgcgcatgccgagctggtcttcaccgatccc
gatgtgcccgaggcggtgctcgccctcgtcggcaccgatctgcccccggcggcgggtccg
gcgcccgccaagaagaacgacaaggccgacaaggccaccgacaagtcggacaagtccgac
aaggccgacaaggccgatgacgccaagtccgacgatccggcggtcatccccggcggaccc
gaggtgcgtcccgcgctcggcgacccggccgaggtcgccaagacgctcgcgtccgaggcg
cgccacggatacaacgtcgtgcgcctgatcgcgggtgacccgctgtcggtggatgccgtg
atcaccgagatcaacgcactggccaagacgcatctgaccttcgagatcgtcccgggtctg
cccgacaccaccgcggttccgacgtacgccggcctgccgctggggtcgtcgcacaccgtc
gccgacgtgcgtggcgacgtcgactgggccgcactggcggccgcgccggggccgctgatc
ctgcatgcgaccgcgtcgcacctgccggatgccgcccgcacgctcatcgagcacgggctc
gtcgagaacacgcccgcggtcgtcacggccaacggcaccacctgccagcagcgttcggtc
gagaccacgctggtggggctcaccgacaagaccgtggtggagaagcccgcgggcagcgag
ctgttgggcccgctgaccggaccgctggtggtcaccatcggcaagaccgtcgccaaccgc
gccaagctgaactggtgggagagccgcgccctgtacggctggaccgtgctggtgccgcgc
accaaggatcaggccggcgagatgagcgagcggctcgtcacgcacggcgccctgccgatc
gaggtgcccaccatcgccgtcgagccgccgcgcagcccggcgcagatggagcgcgcggtc
aagggcctggtcgacggccggttccagtgggtcgtgttcacctccaccaacgccgttcgc
gcggtgtgggagaagttcaacgagttcggtctggacgcccgcgcgttctccggcgtgaag
atcgcctgcgtggggcaggccaccgcggacaaggtgcgcgcgttcgggatcaatcccgaa
ctggtgccgtcgggcgagcagtcctcgctcggcctgctggatgaattcccgccctacgac
gaggttttcgacccggtcaaccgtgtgttgctgccgcgtgcggacatcgccaccgagacg
ctggccgagggtctgcgtgagcgtggctgggagatcgaggacgtcacggcgtaccgcacc
gtgcgtgcggccccgccgcctgcgcacacccgcgagatgatcaagaccggtggtttcgac
gcggtgtgcttcacgtcgagttcgaccgtgcgcaacctcgtcggcatcgcgggcaagccg
cacgcccgcaccatcgtggcctgcatcggaccgaaaaccgcagaaaccgcaatcgaattc
ggtctgcgcgtggatgtgcagcccgagacagccgcggtcggaccgctggtcgaggcgctc
gccgagcacgccgcccggttgcgcgccgagggtgcgctcccgccgccgcgcaagaagagc
cgccgcaggtaa

DBGET integrated database retrieval system