KEGG   Mycobacterium smegmatis MC2 155: MSMEI_1324Help
Entry
MSMEI_1324        CDS       T02191                                 

Definition
sugar kinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MSMEI_1324
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSMEI_1324
   00052 Galactose metabolism
    MSMEI_1324
   00500 Starch and sucrose metabolism
    MSMEI_1324
   00520 Amino sugar and nucleotide sugar metabolism
    MSMEI_1324
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MSMEI_1324
   00524 Butirosin and neomycin biosynthesis
    MSMEI_1324
Enzymes [BR:msg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MSMEI_1324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1458933..1459838
Genome map
AA seq 301 aa AA seqDB search
MTLTLALDIGGTKIAAGLVDDDGALVHQAQLPTPDGDGELIWNVVDELVTGALRVADGAV
DGVGIAAAGPIDLPGGTISPINIVEWQRFPIVDRVAAATGLPVRLGGDGLCMALGEHWRG
AGRGAQFLLGMVVSTGVGGGLVLDGAPYDGRTGNAGHAGHVIVELEDGDLCTCGGHGCVE
TVASGPNMTRWARRQGWQAPADADAKELADAANAGDAVALAAYRRGARAVAAMIASVGAV
CDLDLVVIGGGVAKSGALLFDPIREALKNYAGLDFLRTLQVVPAELGGDAGLIGAAALAR
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcaccctggccctggacatcggtggcaccaagatcgctgccggcctggtcgac
gacgacggcgctctggtgcatcaggctcagctgcccacacccgacggcgacggcgaactg
atctggaacgtcgtcgacgaacttgtcaccggggccctgcgggtggccgacggcgcggtg
gatggggtcggcatcgccgcggccgggcctatcgacctgccaggcggaaccatcagcccc
atcaacatcgtcgagtggcaacggtttccgatcgtcgatcgcgtggctgccgcgaccggg
cttccggtgcggctcggcggtgacggactgtgcatggcgctcggcgagcattggcgtggt
gcgggccggggtgcgcagttcctgctgggcatggtggtgtcgaccggcgtcgggggaggg
ctcgtgctcgacggggcgccgtacgacgggcggaccggcaacgcaggacacgcggggcac
gtcatcgtcgaactcgaagacggagacctgtgcacgtgcggtgggcacggctgcgtcgag
accgtcgcgtccggacccaacatgacgcggtgggcgcgcaggcagggttggcaggcgccg
gccgatgccgacgccaaggagctcgccgacgcggccaacgccggggatgccgtcgcgctc
gcggcgtaccggcgcggtgcacgcgcggttgcggcgatgatcgcgtcggtgggcgcggtg
tgcgatctggatctggtggtgatcggcggcggggtcgcgaagtcgggggcgctgctgttc
gacccgatccgcgaggcactgaagaactacgccggcctggatttcctgcggaccctgcag
gtggtgcctgccgaactcggcggagatgccggcctgatcggggcggcggcgctggcccgg
gcgtga

DBGET integrated database retrieval system