KEGG   Mycobacterium smegmatis MC2 155: MSMEI_1352Help
Entry
MSMEI_1352        CDS       T02191                                 

Gene name
echA5
Definition
(RefSeq) enoyl-CoA hydratase/isomerase (EC:4.2.1.17)
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MSMEI_1352 (echA5)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MSMEI_1352 (echA5)
   00650 Butanoate metabolism
    MSMEI_1352 (echA5)
  Lipid metabolism
   00071 Fatty acid degradation
    MSMEI_1352 (echA5)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MSMEI_1352 (echA5)
   00310 Lysine degradation
    MSMEI_1352 (echA5)
   00360 Phenylalanine metabolism
    MSMEI_1352 (echA5)
   00380 Tryptophan metabolism
    MSMEI_1352 (echA5)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MSMEI_1352 (echA5)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MSMEI_1352 (echA5)
   00281 Geraniol degradation
    MSMEI_1352 (echA5)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MSMEI_1352 (echA5)
   00627 Aminobenzoate degradation
    MSMEI_1352 (echA5)
   00930 Caprolactam degradation
    MSMEI_1352 (echA5)
Enzymes [BR:msg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MSMEI_1352 (echA5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1493749..1494513
Genome map
AA seq 254 aa AA seqDB search
MSEPVRIERNGPVTTVIIDRPEARNAVNGPTAAALFAAFEEFDADDTASVAVLTGANGTF
CAGADLKAFGTPEANQVHREGPGPMGPSRMDLSKPVIAAISGYAVAGGLELALWCDLRVV
DEDATMGVFCRRWGVPLIDGGTVRLPRLIGHSRAMDLILTGRAVDAAEAYAIGLANRVVP
TGQARQAAEELAADLARLPQQCMRADRLSALHQWGESENAAMDFEFASISRVKDEAMHGA
GRFAAGAGRHGANA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaacccgtccggatcgaacgcaacggcccggtcaccacggtcatcatcgaccga
cccgaggcgaggaacgcggtgaacggcccgaccgccgcggcgctgttcgccgcgttcgag
gagttcgacgccgacgacaccgcgtcggtggcggtgttgaccggcgcgaacggaacattc
tgcgcgggagccgatctgaaggcgttcggtacgcccgaggcgaaccaggtgcaccgcgaa
ggtcccgggccgatgggcccgagccggatggacctgtcgaaaccggtgatcgcggcgatc
agcgggtacgccgtcgcaggtggcctcgaacttgcgctgtggtgtgacctgcgcgtggtc
gacgaggacgccacgatgggtgtgttctgccggcgctggggcgtaccgctcatcgacggc
gggacagtgcgcctaccgcggctgatcgggcacagccgcgcgatggacctgatcctcacc
gggcgcgcggtcgacgccgccgaggcgtatgcgatagggctggccaaccgtgtggtcccc
accgggcaggcccgccaggcggccgaggaactcgccgccgacctggcgcgtctgccccag
cagtgcatgcgggccgaccgcctgtcggctctgcaccagtggggcgaatcagagaacgcg
gcaatggatttcgagttcgcctccatatcgcgggtcaaggacgaggccatgcacggggcg
ggacggttcgccgcgggcgcaggccgccacggagcgaacgcgtga

DBGET integrated database retrieval system