KEGG   Mycobacterium smegmatis MC2 155: MSMEI_1634Help
Entry
MSMEI_1634        CDS       T02191                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MSMEI_1634 (deoA)
Enzymes [BR:msg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     MSMEI_1634 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1768919..1770160
Genome map
AA seq 413 aa AA seqDB search
MLSDDAIDWVIDNYTRGRVADEQMSALLMAIFLRGMTPGEITRWTAAMVNSGERFDFTDL
ERDGRPLALVDKHSTGGVGDKLTIPLVPVVIACGAAVPQAAGRGLGHTGGTLDKLEAIPG
FSAELTKTQIRQQLCGVGAAIFAAGELAPADRKIYALRDVTATTESLPLIASSIMSKKLA
EGARALVLDVKVGRGAFLKTEAESRELARTMVELGNDYGVPTRALLTDMNRPLGLSVGNA
VEVAESLDVLAGGGPADVVELTVALAREMLAAAGIDGVDPAETLRDGSAMDRFRALVAAQ
GGDLSLPLPIGAASETVTAPRGGVMGDIDAMGVAMAAWRLGAGRAQPGEPVQLGAGVRLH
RRPGEPVAAGETLFTLYTDTPDRLPAALGELDGAWSVGDAPPQELPLIIDRID
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgctgtccgacgacgccatcgactgggtgatcgacaactacacccgcggccgggtcgcc
gacgaacagatgtcggcgctgctgatggcgatcttcctgcgcggcatgacgccgggcgag
atcacccgctggacggcggccatggtgaactcgggggagcggttcgacttcaccgatctt
gaacgtgacggcaggccactggctttggtcgacaagcactcgaccggtggcgtcggcgac
aaactcaccatcccgctggtgcccgtggtgatcgcgtgcggcgccgccgtgccgcaggcc
gccgggcgcggactcggccacaccggaggcaccctcgacaagctcgaagcgatcccgggg
ttcagcgccgagctcaccaaaacccagatccgccaacagctttgcggggtgggggcggcg
atcttcgccgccggtgagctcgctcccgcagaccgcaagatctacgcactgcgcgacgtc
acggccaccaccgaatccctgcccttgatcgccagctcgatcatgagcaagaaactcgcc
gaaggtgcgcgtgcgctggtgctcgacgtcaaggtcgggcgcggggcgttcctcaagacc
gaggcggagtcccgcgagctcgctcgcaccatggtcgaactcggcaacgactacggcgtg
cccacccgtgcgctgctcaccgacatgaaccggccgctggggctctcggtgggcaatgcg
gtcgaggtcgcggaatccctcgacgtcctcgccggcggcgggcctgccgacgtcgtcgag
ctgaccgtggcgctggcgcgcgagatgctggccgcagcgggcatcgacggtgtcgatccc
gcggagacgctgcgcgacgggtcggccatggatcgcttccgtgccctcgtcgccgcccag
ggcggcgatctcagcctgccgctgccgatcggcgcggcatccgagaccgtcaccgcgccc
cgcggtggcgtgatgggcgacatcgacgcgatgggggtggcgatggccgcctggcgcctg
ggcgccggacgtgcgcagcccggtgaacccgtccaactcggcgccggggtgcggctgcac
cgtcgaccgggggagcctgttgccgccggcgagacactcttcacgctctacaccgacacc
ccggatcggctgcctgccgcgctcggcgagctcgacggcgcctggtccgtcggcgacgcc
ccaccgcaagagctcccgctgatcatcgaccgcatcgactga

DBGET integrated database retrieval system