KEGG   Mycobacterium smegmatis MC2 155: MSMEI_1933Help
Entry
MSMEI_1933        CDS       T02191                                 

Definition
Zn-dependent alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K18382  
NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MSMEI_1933
Enzymes [BR:msg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     MSMEI_1933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2060425..2061450
Genome map
AA seq 341 aa AA seqDB search
MRAVQVVGYHQNLELADVEKPTPTGPFDVVVKIGGAGVCRTDLHILEGQWAEKSQVQLPY
TIGHENAGWVESVGSAVTNVTEGDKVIVHPLITCGLCRACRSGDDVHCESNAFPGIDTNG
GYAEYLKTSARSVVKIDDALEPADVAALADAGLTAYHAAAKAARRLTPRDRVVVIGAGGL
GHIGIQVLKALSPAELIVVDRNPEALKLAEAIGADHCVIADGNQIEQVRDLTGGHGAETV
VDFVGEGGATSEGIAMLRRAGDYHVVGYGENIDVPTIDVISTEINFIGNLVGSYNDLCDL
MALAARGAVNLHTQKYALDDFQSAITDLDNGNVRGRAILVP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgagagctgtgcaggtggtgggctaccaccagaacctggaattggccgacgtggagaag
cccacgccgacaggtccgttcgatgtcgtggtgaagatcggcggcgccggcgtgtgccgg
accgatctgcacatcctcgaaggtcagtgggccgagaagtcacaggtgcaactgccgtac
acgattggccatgaaaatgccggttgggtcgaatctgtcgggtccgcggtcaccaatgtc
acagaaggcgacaaggtgatcgtccatccgctgatcacgtgcgggttgtgccgagcctgc
cgatccggggacgacgtccactgcgagtcgaacgcgtttcccgggatcgacaccaacggc
gggtacgcggagtatctcaagacctccgcacgcagcgtggtcaagatcgacgacgcactg
gagccggccgatgtcgcggccctggccgacgcgggtctgacggcgtatcacgccgccgcc
aaggccgctcgcaggctgacaccccgagaccgggtcgtcgtcatcggcgcaggaggtctg
ggccacatcgggattcaggtgctcaaagcgctgtcaccggccgaactcatcgtcgtcgac
cgcaaccccgaggcgctcaagctcgccgaggcgatcggcgccgaccactgcgtgatcgcc
gacggcaaccagatcgagcaggtgcgcgacctcaccggcggacacggcgccgagaccgtg
gtcgacttcgtcggtgaaggaggcgcgaccagcgaggggatcgccatgttgcgcagggcc
ggtgactaccacgtggtgggctacggcgagaacatcgatgtgcccacgatcgacgtgatc
tccaccgagatcaacttcatcggcaacctcgtcggttcctacaacgacctgtgcgacctg
atggcactggccgcccggggagcggtcaacctgcacacacagaagtacgccctcgacgac
ttccagtccgccatcaccgatctggacaacggcaacgtccgcgggcgcgcgatcctcgtc
ccctga

DBGET integrated database retrieval system