KEGG   Mycobacterium smegmatis MC2 155: MSMEI_2173Help
Entry
MSMEI_2173        CDS       T02191                                 

Gene name
echA1
Definition
enoyl-CoA hydratase EchA1 (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MSMEI_2173 (echA1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MSMEI_2173 (echA1)
   00650 Butanoate metabolism
    MSMEI_2173 (echA1)
  Lipid metabolism
   00071 Fatty acid degradation
    MSMEI_2173 (echA1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MSMEI_2173 (echA1)
   00310 Lysine degradation
    MSMEI_2173 (echA1)
   00360 Phenylalanine metabolism
    MSMEI_2173 (echA1)
   00380 Tryptophan metabolism
    MSMEI_2173 (echA1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MSMEI_2173 (echA1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MSMEI_2173 (echA1)
   00281 Geraniol degradation
    MSMEI_2173 (echA1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MSMEI_2173 (echA1)
   00627 Aminobenzoate degradation
    MSMEI_2173 (echA1)
   00930 Caprolactam degradation
    MSMEI_2173 (echA1)
Enzymes [BR:msg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MSMEI_2173 (echA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2306930..2307694
Genome map
AA seq 254 aa AA seqDB search
MSEEVVLRERRDRTLIITINRPEARNAFNLAVAKGLAEAVDELDDTQELSVGIITGAGGT
FCAGMDLKGFASGELPHVPGRGIGFTEKPPRKPLIAAVEGYALAGGTEIVLATDLVVASR
TAKFGIPEVKRGLVAAGGGLLRLPKRIPYQKALELALTGDNFTAEEAAAWGFVNKLTEPG
EALAGALELAERITANGPLAVAVTKEVIVKSAEWSEAEMWKKQGELIGPVFSSKDAIEGA
TAFAEKRKPNWTGS
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagaagaagtagtcctgagggagcgtcgtgatcggacgctcatcatcacgatcaac
cggccggaagcgcgcaatgcgttcaatctcgcggtggccaaggggcttgccgaggcggtc
gacgaactcgacgacacccaagagctttccgtgggcatcatcaccggtgcgggtggcacc
ttctgtgccggtatggatctcaagggtttcgcctccggtgagctgccgcacgtgccgggc
cgcggaatcggcttcaccgagaagccgccccgcaaaccgctcatcgccgcggtggaaggc
tacgcgctggcgggaggcaccgagatcgtgctggccaccgacctcgtcgtggcgagcagg
accgcgaagttcggcatccccgaggtgaagcgcggactggtcgccgcgggcggcggtctg
ctgcggctgcccaagcgcatcccgtaccagaaggcgctcgagctcgcgctgaccggtgac
aacttcaccgccgaggaggctgccgcctggggcttcgtcaacaagctgaccgagccagga
gaggcgctggccggtgccctcgagctcgccgagcgcatcaccgccaacggcccactggcc
gtcgcggtcaccaaggaggtgatcgtcaagtcggccgagtggtcggaggccgagatgtgg
aagaaacagggtgagttgatcgggccggtcttctcgtcgaaggacgcgatcgaaggcgcc
actgcgttcgccgagaaacgcaaacccaactggacaggttcctga

DBGET integrated database retrieval system