KEGG   Mycobacterium smegmatis MC2 155: MSMEI_2289Help
Entry
MSMEI_2289        CDS       T02191                                 

Definition
glycoside hydrolase, family 57
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MSMEI_2289
Enzymes [BR:msg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     MSMEI_2289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2431640..2433184)
Genome map
AA seq 514 aa AA seqDB search
MTDASAEPVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLVRVLRTLAAEGR
SHLISLGMTPVVTAQLDDPYCLTGMHHWLANWQLRALEATTLRDRKGLREFGSHELSLAA
EAMEDFTTHWRHGASPLLRELIDAETIELLGGPLSHPFQPLLNPRLREFALREGLADSQH
RFAHTPTGIWAPECAYAPGMETGYGAAGVGHFMVDGPSLHGDTALGRPVGESDVIAFGRD
LQVSYRVWSPKSGYPGHGAYRDFHTYDHTTGLKPARVTGRNVPSEQKAPYEPERADRAVD
VHVADFVEVVRRRLLDESQRIGRPAHVVAAFDTELFGHWWHEGPVWLERVLRALPQAGVR
VGTLADAAADGFVGTPVELPPSSWGSGKDWQVWSGQKVADLVQLNSEVVDNALATVDKAL
TQHATVGSPVTRDRVADQILRETLLTVSSDWPFMVSKDSAAEYARYRAHLHAHATREISD
ALAAGRREQAERLADGWNKADGLFGALDARRLPR
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgcgagcgcagaaccggtaccgggacttttcaccctcgtcctgcacacccac
ctgccctggctggcccaccacggccgctggcccgtcggcgaggaatggctgtaccagtcc
tgggccgcggcgtatctgccactggtgcgggtgctgcgcacgctggccgccgagggccgt
tcccatctgatcagcctcggcatgacgccggtggtcaccgcgcaactcgacgatccctac
tgcctgaccggcatgcaccactggctggccaactggcagctgcgcgcgctggaggccacc
acgctgcgcgaccgtaaaggtctgcgcgagttcggatcccacgaactgtcgctggccgcg
gaggccatggaggatttcaccacgcactggcgccacggcgcgagcccgctgctgcgcgaa
ctgatcgacgccgagaccatcgaactgctcggcggcccgttgtcgcacccgttccagccg
ctgctcaatccccgcctgcgcgagttcgcgttgcgcgagggcctggccgattcgcagcac
cggttcgcccacacccccaccgggatctgggcgccggagtgtgcctatgcccccggcatg
gaaaccggttacggcgcagcgggtgtcgggcacttcatggtcgacggcccgtcactgcac
ggcgacaccgcgctcgggcgcccggtcggtgagtccgacgtcatcgcgttcggccgcgat
ctgcaggtgtcctaccgcgtgtggtcgcccaagtcgggatatcccggccacggcgcgtac
cgcgacttccacacctacgaccacaccacgggcctcaaacccgcccgtgtgacagggcgc
aacgtgccgtcggagcagaaggcgccctacgaacccgagcgcgccgaccgtgccgtcgac
gtccatgtcgccgacttcgtcgaggtcgtgcgcaggcgtctgctcgacgagagccaacgc
atcggccgcccggcgcacgtggtcgcggcgttcgacaccgaactgttcggccactggtgg
cacgagggcccggtgtggctcgaacgcgtgctgcgggcactgccgcaggccggtgtgcgc
gtcggcacgctcgcggatgccgccgcggacggattcgtcggcacacccgtcgaattgccg
cccagctcatggggttccggcaaggactggcaggtgtggtcggggcagaaggtggccgat
ctggtgcagctcaacagcgaggtcgtcgacaacgcgctggccaccgtcgacaaggccctg
acccagcacgccacggtgggctcacccgtcacgcgcgaccgcgtcgccgatcagatcctg
cgcgagaccttgctgacggtctccagcgactggccgttcatggtgagcaaggattcggcc
gccgagtacgcgcgctaccgggcccacctgcacgcacacgccacgcgggagatctccgac
gcgctggccgccgggcgccgcgaacaggccgagcgtctggccgacggctggaacaaggcc
gacggcctcttcggggcactcgacgcgaggcggctcccgcgatga

  All links  
No link information was found.   
DBGET integrated database retrieval system