KEGG   Mycobacterium smegmatis MC2 155: MSMEI_2553Help
Entry
MSMEI_2553        CDS       T02191                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MSMEI_2553
Enzymes [BR:msg01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     MSMEI_2553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2696787..2698670
Genome map
AA seq 627 aa AA seqDB search
MIQQTYPLSAIVGQDRLRLALVLCAVRPEIGGVLIRGEKGTAKSTAVRGLAAVLAAVDED
AKLVELPIGATEDRVVGSLDLQKVLRDGEHAFSPGLLARAHGGVLYVDEVNLLHDHLVDV
LLDAAAMGRVHVERDGISHSHEARFVLIGTMNPEEGELRPQLLDRFGLTVDVTASRDVDV
RVEVIRARMDFEADPEGFVRRHAEADAELSRRIAAARDLVDSVVLPDTELRRIAALCAAF
DVDGMRADLVVARTAVAHAAWRGAGTVSEEDVRVAAELALPHRRRRDPFDDPGLDPDRLD
EAMQQAGEQAEAGPESNPETDPETDPDFDPDFDPPGGGATTDSDAAAPQGKPKSSSTRQS
APPAATFRTRALVVPGIGEGAPGKRSRARNRTGKPIAATAEPGEGHGVHVFGTLLATAGR
QREPGRPRPVPEDIRRAVREGREGNLVIFVVDASGSMAARDRMSAVSGAAMSLLRDAYQR
RDKVAVITFRGQDARVLLPPTSSVYIASRRLARFDTGGKTPLAQGLLAARDVVIREKARD
RARRSLVVVLTDGRATGGPDPLQRARRAAAALVAEGTAAVVVDCETSFVRLGLAQELATQ
LGGEAVRLEQLRADELTRLVKTRSDAA
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
gtgatccagcagacgtatcccctgagcgcgatcgtcgggcaggaccggctgaggctcgcg
ctcgtgctgtgtgccgtgcgtcccgagatcggcggtgtgctgatccgcggcgagaagggc
accgcgaaatccactgctgtgcgcggacttgccgctgtgctcgcagccgtcgacgaggac
gcgaaactggtcgaactgcccatcggcgccaccgaggaccgtgtggtcggctcgctggat
ctgcagaaggtgctgcgcgacggcgaacacgcgttctcgccgggcctgctggcccgcgcg
cacggcggcgtgctgtacgtcgacgaggtgaacctgctgcacgaccacctggtggacgtt
ctgctcgacgcggccgccatgggacgcgtgcacgtcgaacgcgacggcatctcgcactcg
cacgaggcgcggttcgtcctgatcggcaccatgaaccccgaagaaggggaactgcggccc
cagctgctggaccggttcggcctgaccgtcgacgtgaccgcgtcgcgcgacgtcgacgtc
cgagtcgaggtgatccgtgcccgaatggatttcgaggccgacccggagggcttcgtgcgc
cgccacgccgaggccgacgccgagttgtcgcggcgcatcgccgcggcgcgggacctggtc
gactcggtggtgttgcccgacaccgagttacggcgcatcgccgcgctgtgtgcggcgttc
gacgtggacggtatgcgcgccgatctggtcgtggcccgtaccgcggtcgcccacgcggca
tggcgcggggcgggcaccgtgtccgaggaggacgtgcgggtggccgccgagttggcgttg
ccgcaccggcgccgtcgcgatcccttcgacgatcccggactggacccggatcgcctcgac
gaggccatgcagcaggcgggggagcaggccgaggccggtccggaaagcaacccggaaacc
gacccggaaaccgatccggacttcgaccccgatttcgacccacccggcggcggtgccacc
accgattcggatgccgctgcgccgcagggtaagccgaaaagctcctcgacacggcagagc
gcgccgcctgcggcaaccttccgcacaagggcgctcgtggtgcccgggatcggtgagggt
gcccccggtaagcgctcgcgtgcgcgcaaccgcacgggcaagcccatcgccgcgacggca
gaaccgggcgagggccacggtgtgcacgtgttcggcacgctgctcgccaccgccgggcgc
cagcgggaaccgggacggccgcgaccggtgccagaggacatccggcgcgcggtgcgcgaa
ggacgtgagggcaacctggtgatcttcgtcgtcgacgcatcggggtcgatggccgcgcgc
gaccgcatgtccgcggtcagcggggctgcgatgtcgctgctgcgcgacgcctatcagcgt
cgcgacaaggtcgcggtgatcaccttccgcgggcaggacgcccgcgtgctgctgccgccg
acgtcgtcggtgtacatcgcgagccgtcggctcgcgcggttcgacaccggcgggaaaacc
ccgctggcgcagggactcctggccgcccgtgacgtggtgatccgggagaaggcccgtgac
cgggcacgccgcagcctggtggtggtgctcaccgacggccgtgcgaccgggggcccggac
ccgctgcagcgcgccaggcgggccgccgccgcgctggtcgccgagggcacggccgccgtg
gtcgtcgactgcgaaacctcgttcgtgcggctgggtttggcgcaggaactggccacgcag
ctgggcggtgaggccgtacggctggagcagctgcgggcagacgagttgacccggctggtc
aagaccaggtcagacgcggcgtag

DBGET integrated database retrieval system