KEGG   Mycobacterium smegmatis MC2 155: MSMEI_2607Help
Entry
MSMEI_2607        CDS       T02191                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:msg00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:msg00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2751979..2752449
Genome map
AA seq 156 aa AA seqDB search
MSMRLIWAQSTSGIIGRDNSIPWRLPEDLARFKEMTMGHPVVMGRLTWESLPASVRPLPG
RRNIVVTRDADYRAEGAEVVTDLPDEPDAWVIGGAQIYAMALARADRCEVTEVDIALTPL
DGDARAPVLDDSWVATTGEWQTSTSGLRFRFCSYRR
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgagtatgagactgatctgggcccagtcgacctcagggatcatcggccgggacaactcc
attccatggcgtctgcccgaggacctcgcccggttcaaggagatgaccatgggccatccg
gtggtgatgggacggctcacgtgggagtcgctgcctgcctcggtgcgcccgctgccgggg
cgccgcaacatcgtcgtgacccgtgacgccgactaccgggccgagggcgccgaggtggtc
accgacctgcccgacgaacccgatgcgtgggtgatcggcggcgcccagatctatgcgatg
gcactggcgcgggccgaccgctgtgaggtcaccgaggtcgacatcgccctgacgccactc
gacggtgatgcgcgcgcaccggtgctcgacgactcgtgggtcgcgacgacgggtgagtgg
cagaccagtacgtcaggcctgcgtttccggttctgcagctaccggcgctga

DBGET integrated database retrieval system