KEGG   Mycobacterium smegmatis MC2 155: MSMEI_2632Help
Entry
MSMEI_2632        CDS       T02191                                 

Definition
limonene-1,2-epoxide hydrolase (EC:3.3.2.8)
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MSMEI_2632
Enzymes [BR:msg01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     MSMEI_2632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2774394..2774822)
Genome map
AA seq 142 aa AA seqDB search
MADQTTVQNPIATVETFLNALQEQDFDTAENALAQNLVYQNVGMPTIYGRNRAMKLFRSM
QGRAGFEVKIHRSAADGAAVLNERTDVLTFGPLRVQFWVCGVFEVHDGRITLWRDYFDYL
DIFKATVRGLLGMVVPSLRAKL
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atggctgaccaaacaacggtgcagaacccgatcgccacggtcgagacgttcctcaacgcg
ctgcaggaacaggacttcgacaccgcggagaacgcgctggcgcagaacctcgtctaccag
aacgtgggcatgccgaccatctatggtcgcaaccgcgccatgaagctgttccggtccatg
caggggcgggccggtttcgaggtcaagatccatcgcagcgcggccgacggcgccgcggtg
ctcaacgagcgcaccgatgtcctcacgttcggcccgctgcgggtccagttctgggtgtgc
ggtgtgttcgaggtgcacgacggccggatcacgctgtggcgcgactacttcgattacctc
gacatcttcaaggcgaccgtgcgtggtctgctcggcatggtcgtcccgtcgctgcgcgcc
aagctgtga

DBGET integrated database retrieval system