KEGG   Mycobacterium smegmatis MC2 155: MSMEI_2870Help
Entry
MSMEI_2870        CDS       T02191                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:msg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MSMEI_2870 (ruvA)
Enzymes [BR:msg01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MSMEI_2870 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3006463..3007050
Genome map
AA seq 195 aa AA seqDB search
MIASVRGEVIDIALDHAVIEAAGVGYKVMATPSTLATLRRGTEARLITAMIVREDSMTLY
GFVDGDARDLFLTLLGVSGVGPKIALATLAVYDPQALRQALADGDVTALTRVPGIGKRGA
ERMVLELRDKIGPVSAGGGAAVGGHAIRGPVVEALVGLGFAAKQAEEATDKVLANDPEAT
TSSALRAALSMLGKK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgtcggtccgcggtgaggtcatcgacatcgcgctcgaccacgccgtgatcgag
gcggcaggcgtgggctacaaggtcatggccaccccgtcgacgctcgcgacgctgcggcgc
ggcaccgaggcccggctcatcaccgcgatgatcgtgcgcgaggactcgatgacgctgtac
gggttcgtcgacggcgacgcgcgggatctgttcctcacactgctcggggtgtccggggtc
gggccgaagatcgcgctggccacactggccgtgtacgacccgcaggcgctgcggcaggcg
ctggccgatggtgacgtcaccgcgctgacccgcgtgcccggtatcggcaagcgcggcgcc
gagcgcatggtgctcgaactgcgcgacaagatcggacccgtcagcgcgggcgggggcgca
gcggtcggcggacacgcgatacgcggaccggtggtggaagcccttgtgggtctgggcttc
gccgccaagcaggccgaggaggccaccgacaaggtgctggccaacgaccccgaggccacc
acgtcgtccgcgctgcgcgcggcgctgtccatgttgggtaagaagtaa

DBGET integrated database retrieval system