KEGG   Mycobacterium smegmatis MC2 155: MSMEI_2976Help
Entry
MSMEI_2976        CDS       T02191                                 

Gene name
gmk
Definition
Guanylate kinase Gmk (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MSMEI_2976 (gmk)
Enzymes [BR:msg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MSMEI_2976 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3126915..3127517
Genome map
AA seq 200 aa AA seqDB search
MTVGRGAGQRATDGPARARVVVLSGPSAVGKSTVVRCLRERLPDLYFSVSVTTRAPRPGE
VDGVDYTFVSPERFQQLIDDGELLEWAEIHGGLHRSGTPAAPVREATRAGRPVLIEVDLA
GARAVKQAMPEVVSVFLAPPSWDELVRRLSGRGTETPEVMARRLDTARAEMAAQSDFDRV
VVNRQLDSACAELVSLLVDS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
ttgactgtcggccgtggggccggacaacgcgcgactgatgggcccgcacgggcccgggtc
gtcgtgctgtccggcccctcagctgtcgggaagtcaaccgtggtccgctgtctgcgggaa
cggcttcctgacctgtacttttccgtgtccgtcaccaccagggcgccccgtcccggggag
gtcgacggcgtggactacacctttgtcagcccggaacgcttccagcagttgatcgacgac
ggggaactgctcgaatgggccgagatccacggcggtctgcaccgctcgggcacgcccgcc
gcaccggtccgtgaggccaccagggcaggccgaccggtactgatcgaggtcgacctggcc
ggcgcgagggccgtcaagcaggccatgcccgaggtcgtctcggtgttcctggccccgccg
agctgggacgaactcgtgcgccgcctgtccggccgcggcaccgaaacgcccgaggtgatg
gcccggcgcctggacaccgccagagccgaaatggctgcacaatccgatttcgaccgcgtc
gtggtgaaccggcagttggattcggcatgcgcggaattggtatccttgctggtggacagc
tga

DBGET integrated database retrieval system