KEGG   Mycobacterium smegmatis MC2 155: MSMEI_3138Help
Entry
MSMEI_3138        CDS       T02191                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MSMEI_3138 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MSMEI_3138 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MSMEI_3138 (trpB)
Enzymes [BR:msg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MSMEI_3138 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3299513..3300790
Genome map
AA seq 425 aa AA seqDB search
MAYHAGPDLPRSSAGVAEPTSHDPDARGHFGPYGGRLVPEALMAVIEEVTAAYEKCRGDQ
TFLDELDRLQRHYSGRPSPLYEATRLSEHAGGARIFLKREDLNHTGSHKINNVLGQALLA
RQMGKTRVIAETGAGQHGVATATACALLGLECVIYMGAVDTARQALNVARMRLLGATVVS
VEAGSKTLKDAINEAFRDWVTNADETYYCFGTAAGPHPFPLMVRDFQRIIGLEARVQVQD
QAGRLPDAVTACVGGGSNAIGIFHAFIDDPGVRLIGFEAAGDGVETGRHAATFTGGSPGA
FQGSFSYLLQDEDGQTIESHSISAGLDYPGVGPEHALLKDIGRAEYRPITDTEAMDAFRL
LCRTEGIIPAIESAHAVAGALKLGPELGAGSVIVVNLSGRGDKDVETAAKWFGLLDEGQG
EGEAR
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcgtatcacgccggcccggacctgccgcgttccagcgcgggggtggccgaacccacg
tcccacgaccccgacgcgcgcgggcacttcggtccgtacggcggccgcctcgtccccgag
gcgctgatggcggtgatcgaagaggtcaccgccgcctacgagaagtgccgcggcgaccag
acgttcctcgacgaactcgaccgcctgcagcgtcactacagcggcaggccgtcgccgctg
tacgaggcgacgcggttgtccgagcacgccggcggcgcgcgcatcttcctcaagcgggaa
gacttgaaccacaccggatctcacaagatcaacaacgtgctggggcaggccctgctggcg
cgtcagatgggcaagacgcgcgtcatcgccgagaccggcgccggtcagcacggcgtggcc
accgcgaccgcgtgtgccctgctgggactcgagtgcgtcatctacatgggcgcggtcgac
acggcccgccaggcgctcaacgtcgcccgcatgcgactgctcggcgcgaccgtggtgtcg
gtcgaggccggttccaagaccctcaaggacgccatcaacgaggcgttccgcgactgggtg
accaacgccgacgagacgtactactgcttcggcaccgccgcgggcccgcatccgttcccg
ctcatggtccgtgacttccagcggatcatcggcctggaggcccgggttcaggtccaggac
caggccgggcggctgcccgacgcggtgaccgcatgcgtcggcggcggctcgaacgccatc
ggcatcttccacgccttcatcgacgatccgggtgtccgtctgatcggattcgaggccgca
ggcgacggcgtggagaccggcaggcacgccgcgaccttcaccggtggttcgcccggcgcg
ttccaggggtcgttctcctacctgttgcaggacgaggacgggcagaccatcgagtcccat
tcgatctcggcgggtctggactacccgggcgtcggacccgagcacgccctgctcaaggac
atcgggcgcgccgaataccggcccatcaccgacaccgaggccatggacgccttccgcctg
ctgtgccgcaccgaggggatcatcccggcgatcgaatccgcgcacgccgtggcgggtgcg
ctcaagctgggccccgaactcggcgcgggatcggtcatcgtggtgaacctgtccggacgt
ggtgacaaggacgtcgagaccgcggccaagtggttcggcctgctcgacgaaggacagggc
gaaggagaagcccgatga

DBGET integrated database retrieval system