KEGG   Mycobacterium smegmatis MC2 155: MSMEI_3455Help
Entry
MSMEI_3455        CDS       T02191                                 

Definition
Agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:msg00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3598682..3599725
Genome map
AA seq 347 aa AA seqDB search
MGDDHGHEHGPRRELPPGLAEQLDLPYAGMVSFGHRPFLTETQQLDEWRPDVAIVGAPFD
IATTNRPGARFGPRAIRATAYEPGTYHLDLGLEIFDWLEVVDFGDAYCPHGQTEVSHANI
RERVHAVASRGVVPVVLGGDHSITWPSATAVADVHGYGNVGIVHFDAHADTADNIEGNLA
SHGTPMRRLIESGAVPGSHFVQVGLRGYWPPQDTFEWMLEQKMTWHTMQEIWDRGFKAVM
DDAVGEALAKAEKLYLSVDIDVLDPAHAPGTGTPEPGGITSADLLRMVRQLCHRHDVAGV
DVVEVAPAYDHAELTVNAAHRVVFEALAGMAARRRDAAQAQPGPPAR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacgatcacgggcacgagcacgggccgcggcgtgagctgccgcccggactggcc
gaacaactcgaccttccctacgcgggcatggtgtcgttcgggcaccggccgtttctgacc
gagacacagcaactcgacgagtggcgtcccgacgtcgcgatcgtcggagccccgttcgac
atcgcgaccaccaaccgcccgggcgcgcgcttcggcccgcgcgcgatccgcgcgacggcc
tacgaaccgggcacctatcacctggatctcggcctggagatcttcgactggctcgaggtg
gtcgatttcggtgacgcgtactgcccacacgggcagaccgaggtgtcgcacgccaacatc
cgtgagcgcgtgcacgcggtcgcgtcccgcggcgtcgtcccggtggtgctcggcggggac
cattccatcacctggccgtcggcgaccgccgtggccgatgtgcacggctacggcaacgtc
ggcatcgtgcatttcgacgcccacgccgacacggccgacaacatcgagggcaacctcgcg
agccacggcaccccgatgcgccggctcatcgaatcgggcgccgtgcccggcagccacttc
gtacaggtcgggctgcggggttactggccgccgcaggacacgttcgagtggatgctcgaa
cagaagatgacctggcacaccatgcaggagatctgggaccgcggattcaaggccgtgatg
gacgacgcggtcggcgaggcgctggcgaaggccgaaaagctctatctctccgtagatatc
gatgttctggacccggcgcacgcgcccggcacgggaactcccgagccgggcgggatcacc
agcgccgacctcttacgcatggtccggcagttgtgtcaccgccacgacgtggccggcgtc
gacgtggtcgaggtcgcgcccgcctacgaccacgccgaactgacagtgaacgccgcgcac
cgcgtggtgttcgaggcgctcgcgggtatggcggcgcgcaggcgtgacgcggcacaggcc
cagccggggccacccgcgcgatag

DBGET integrated database retrieval system