KEGG   Mycobacterium smegmatis MC2 155: MSMEI_3730Help
Entry
MSMEI_3730        CDS       T02191                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
msg00220  Arginine biosynthesis
msg00250  Alanine, aspartate and glutamate metabolism
msg00471  D-Glutamine and D-glutamate metabolism
msg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MSMEI_3730
   00220 Arginine biosynthesis
    MSMEI_3730
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    MSMEI_3730
Enzymes [BR:msg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     MSMEI_3730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AFP40188
UniProt: I7FNA6
Position
complement(3890297..3891220)
Genome map
AA seq 307 aa AA seqDB search
MPFAPVAGEQMHEYLRAAELRGRRAALRGMVSRQIPALAAVPATRFAMAVATVDGAEACI
GEASTAFSIQSLSKLFALCALLRHEPDVWTDVGWVPTDAGYGSVADLERNHWRPRNPFVN
SGALVVTDRLMTHAGDAVGATIEVLQAGDPDAPVRSDPAVALSESEADHRNSAIAHVLAE
HGRLVNDIDRVLPQYFAQCAIAASVRTIARAALFLADRTGERTVLDDDSVRRVNAVLLTS
GMYGAAGDIAYRIGLPAKSGIGGGVLAVMPGHGTVCVWSPPLDDDGNSAGGVAAIEEFAR
LAGWSVF
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgccgtttgcgccggtggccggcgagcagatgcacgagtatctgcgagcggcggagttg
cgcggccgccgcgccgcgctgcgcgggatggtgagccgccagatacccgcactcgccgcg
gtgcccgccacgcggttcgcgatggccgtcgccaccgtcgacggcgccgaggcctgcatc
ggcgaggcgtccacggccttctccatccagagcctgtccaagctgttcgcgctgtgcgcg
ctgctgcggcacgaaccggatgtctggaccgacgtgggatgggtgcccaccgacgcgggg
tacgggtcggtggccgatctggagcgcaaccactggcggccgcgcaatccgttcgtgaac
tccggcgccctcgtcgtcaccgaccggctcatgacgcatgccggcgatgccgtcggcgcg
acgatcgaggtgctgcaggcgggtgacccggacgctcccgtgcgctccgacccagcggtg
gcgctctcggaaagcgaagccgaccaccgcaattcggccatcgcgcacgtcctggccgag
cacggcaggctggtcaacgacatcgaccgggtgctgccgcagtacttcgcacagtgcgcg
atcgcggcgtcggtgcgcacgatcgcacgcgcggcactgtttctcgccgaccggaccggg
gagcggaccgtcctggacgacgacagcgtgcgccgggtcaacgcggtgctgttgacctcg
gggatgtacggcgcggccggcgacatcgcgtaccgcatcgggctgcccgccaagagtggc
atcggcggcggcgtgctggccgtgatgcccggtcacggcacggtgtgcgtgtggagcccg
ccgctcgacgacgacgggaactccgcaggtggcgtcgccgcgatcgaggagttcgcgcgg
ttggccggctggtcggtgttctag

DBGET integrated database retrieval system