KEGG   Mycobacterium smegmatis MC2 155: MSMEI_3826Help
Entry
MSMEI_3826        CDS       T02191                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MSMEI_3826
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSMEI_3826
  Lipid metabolism
   00071 Fatty acid degradation
    MSMEI_3826
  Amino acid metabolism
   00350 Tyrosine metabolism
    MSMEI_3826
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MSMEI_3826
   00626 Naphthalene degradation
    MSMEI_3826
Enzymes [BR:msg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MSMEI_3826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3985391..3986455)
Genome map
AA seq 354 aa AA seqDB search
MRAARMHGYKQPLRLEEIPVPTPGPEEVLVEVGGAGMCRTDFQLIDGYFDRGQDMGFPFT
PGHEIAGWVDSIGSQVPASAGLSEGDQVVVYGGWGDGTCRQCQGGNEQICPQGHWVGFGG
HGGYQEYVPVHHRYLIPVAGRDGLTPATLAPLTDAGLTPYRGLKKLRAAGVLGAGRTVAV
TGIGGLGSYGTQYAKLLGGGAAVVAFARSDEKLKVATDNGADHAINVRDKSAEEVRGELQ
NLTGRGEIDAVIECAGSVESIQLAFDLLATEGAVASVGLIGNRIDIPLFPLVAREFSYFG
SFWGNYNDLTEVLALAEAGQIRHTVTPVQFDDINATIDAIAAGEVLGRAVVVYD
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccgcccgcatgcatgggtacaagcaaccgttgcggcttgaggagatacccgtc
ccgacgccgggaccggaggaggtgctggtggaggtcggcggtgccgggatgtgccgcacc
gattttcagctcatcgacggctacttcgaccgtgggcaggacatgggattcccgttcacc
cccggccacgagatcgcaggatgggtcgactcgatcggttcacaggtcccggcctctgcc
ggactgtcggagggggaccaggtggtcgtctacggcgggtggggtgacggcacgtgccgt
cagtgtcaaggtggaaacgagcagatctgcccgcaggggcactgggtcggattcggcggg
cacggcggctaccaggagtacgttcccgtccatcaccgctacctcatccccgttgcgggc
cgcgatggattgacaccggcgacgttggccccgttgaccgacgccggcctgactccctac
cgcgggttgaagaagttgcgtgcggcgggggttctcggcgctgggcgcactgtggcggtg
accggcatcggcgggctgggaagctatggcacgcagtacgcgaagttgctgggcggggga
gcggcagtcgtcgcgtttgcccgcagcgacgagaaactcaaggtcgcgacggataacggt
gccgaccatgccatcaacgtccgcgacaagagcgccgaagaggttcgcggcgaactccag
aacctgaccggccgaggcgaaatcgacgccgtgatcgagtgtgccggatcggtcgagtcc
atccaactggccttcgacctgttggccacggaaggcgcggtggcctcggtgggattgatc
ggcaaccgcatcgacatcccgttgttcccgttggtggcacgcgaattcagctatttcggc
tcgttctggggcaactacaacgacctgacagaggttcttgcgttggccgaggccggccag
atcaggcacacagtcacgcccgtccagttcgacgacatcaacgccaccatcgacgcgatc
gccgcgggcgaggtgttgggccgcgccgtcgtcgtctacgactga

DBGET integrated database retrieval system