KEGG   Mycobacterium smegmatis MC2 155: MSMEI_3857Help
Entry
MSMEI_3857        CDS       T02191                                 

Gene name
pfkB
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MSMEI_3857 (pfkB)
   01230 Biosynthesis of amino acids
    MSMEI_3857 (pfkB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSMEI_3857 (pfkB)
   00030 Pentose phosphate pathway
    MSMEI_3857 (pfkB)
   00051 Fructose and mannose metabolism
    MSMEI_3857 (pfkB)
   00052 Galactose metabolism
    MSMEI_3857 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    MSMEI_3857 (pfkB)
Enzymes [BR:msg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MSMEI_3857 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4019063..4020025)
Genome map
AA seq 320 aa AA seqDB search
MDTGRPNIVTLTMNPALDITTCADQVRHTDKIRCGATRYDPGGGGINVARVAHVLDGPVV
AVFTSGGPTGAMVADLVRREGVAYEPVEISGVTRESFTVNEGCTGKQYRFVLPGPHLTMT
EQAQCVENLRRHAMSAEFVVASGSLPPGVDPRFYQQIADMCRESGVPLILDTSGGGLSHI
ESGVFVLKPSLRELRECTGKELTTEREQVAAARDLIDRGVTDVVIVSLGGDGALMVTARQ
SQRFKAVPVASGSGVGAGDAMVAAITVGLSRGWPLPKSVRYGIAAGAAMLLTPGTAVCRR
AEVERLFALAAEPEDLTSGW
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggataccggcagaccgaacatcgtgacgttgacgatgaatccggcgctggacatcacg
acctgtgccgaccaggttcggcacacggacaagatccgttgtggcgcaacccggtacgat
ccaggcggcggcggcataaacgtggctcgcgtcgcgcacgtcctggacggaccggtagtt
gccgtgttcacatctggcggccctaccggtgcgatggtggccgacctggtgcggcgggaa
ggtgtggcgtacgaacctgtcgagatctcgggggtgacgcgtgagagcttcaccgtgaac
gagggttgtacgggcaagcagtaccgtttcgtgctgccgggcccgcacctgaccatgacc
gaacaggcgcagtgcgtggaaaacctgcgccgccacgccatgtcggcggagttcgtggtg
gccagtggcagcctgccaccaggtgtggatccccggttctatcagcagattgccgacatg
tgtcgtgaatccggggtaccgctcatcctcgacacctcgggtgggggactgtcacacatc
gaatcgggggtgttcgtactgaagcccagtttgcgggagttgcgcgaatgcacaggcaag
gaactgaccaccgagcgtgagcaggtcgccgcggcgagggacctcatcgatcgtggtgtg
acagacgtggtcatcgtgtcgttggggggcgacggagccctcatggtgaccgcgcgtcag
agccagcggttcaaggccgtgccggtggcatctggcagcggggtcggagcaggggatgcg
atggtcgcggccatcacggtcggcctgagccgtgggtggccgctgcccaagtcggtgcgt
tacggcatcgcggccggcgcggcgatgctgctgaccccgggcaccgcggtgtgccgacgc
gccgaggtcgagcggttgttcgcgttggcggccgagcccgaggatctcacctcggggtgg
tga

DBGET integrated database retrieval system