KEGG   Mycobacterium smegmatis MC2 155: MSMEI_3857Help
Entry
MSMEI_3857        CDS       T02191                                 

Gene name
pfkB
Definition
(GenBank) 6-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
msg00010  Glycolysis / Gluconeogenesis
msg00030  Pentose phosphate pathway
msg00051  Fructose and mannose metabolism
msg00052  Galactose metabolism
msg00680  Methane metabolism
msg01100  Metabolic pathways
msg01110  Biosynthesis of secondary metabolites
msg01120  Microbial metabolism in diverse environments
msg01130  Biosynthesis of antibiotics
msg01200  Carbon metabolism
msg01230  Biosynthesis of amino acids
Module
msg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSMEI_3857 (pfkB)
   00030 Pentose phosphate pathway
    MSMEI_3857 (pfkB)
   00051 Fructose and mannose metabolism
    MSMEI_3857 (pfkB)
   00052 Galactose metabolism
    MSMEI_3857 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    MSMEI_3857 (pfkB)
Enzymes [BR:msg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MSMEI_3857 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AFP40315
UniProt: I7FFW7
Position
complement(4019063..4020025)
Genome map
AA seq 320 aa AA seqDB search
MDTGRPNIVTLTMNPALDITTCADQVRHTDKIRCGATRYDPGGGGINVARVAHVLDGPVV
AVFTSGGPTGAMVADLVRREGVAYEPVEISGVTRESFTVNEGCTGKQYRFVLPGPHLTMT
EQAQCVENLRRHAMSAEFVVASGSLPPGVDPRFYQQIADMCRESGVPLILDTSGGGLSHI
ESGVFVLKPSLRELRECTGKELTTEREQVAAARDLIDRGVTDVVIVSLGGDGALMVTARQ
SQRFKAVPVASGSGVGAGDAMVAAITVGLSRGWPLPKSVRYGIAAGAAMLLTPGTAVCRR
AEVERLFALAAEPEDLTSGW
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggataccggcagaccgaacatcgtgacgttgacgatgaatccggcgctggacatcacg
acctgtgccgaccaggttcggcacacggacaagatccgttgtggcgcaacccggtacgat
ccaggcggcggcggcataaacgtggctcgcgtcgcgcacgtcctggacggaccggtagtt
gccgtgttcacatctggcggccctaccggtgcgatggtggccgacctggtgcggcgggaa
ggtgtggcgtacgaacctgtcgagatctcgggggtgacgcgtgagagcttcaccgtgaac
gagggttgtacgggcaagcagtaccgtttcgtgctgccgggcccgcacctgaccatgacc
gaacaggcgcagtgcgtggaaaacctgcgccgccacgccatgtcggcggagttcgtggtg
gccagtggcagcctgccaccaggtgtggatccccggttctatcagcagattgccgacatg
tgtcgtgaatccggggtaccgctcatcctcgacacctcgggtgggggactgtcacacatc
gaatcgggggtgttcgtactgaagcccagtttgcgggagttgcgcgaatgcacaggcaag
gaactgaccaccgagcgtgagcaggtcgccgcggcgagggacctcatcgatcgtggtgtg
acagacgtggtcatcgtgtcgttggggggcgacggagccctcatggtgaccgcgcgtcag
agccagcggttcaaggccgtgccggtggcatctggcagcggggtcggagcaggggatgcg
atggtcgcggccatcacggtcggcctgagccgtgggtggccgctgcccaagtcggtgcgt
tacggcatcgcggccggcgcggcgatgctgctgaccccgggcaccgcggtgtgccgacgc
gccgaggtcgagcggttgttcgcgttggcggccgagcccgaggatctcacctcggggtgg
tga

DBGET integrated database retrieval system