KEGG   Mycobacterium smegmatis MC2 155: MSMEI_4051Help
Entry
MSMEI_4051        CDS       T02191                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MSMEI_4051
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MSMEI_4051
   00650 Butanoate metabolism
    MSMEI_4051
  Amino acid metabolism
   00360 Phenylalanine metabolism
    MSMEI_4051
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MSMEI_4051
   00622 Xylene degradation
    MSMEI_4051
   00621 Dioxin degradation
    MSMEI_4051
Enzymes [BR:msg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MSMEI_4051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4230803..4231738
Genome map
AA seq 311 aa AA seqDB search
MDKVKVAIIGSGNIGTDLMMKTLRSSSLEMAVLVGVDPRSDGLARAERLGIATTSGGLDH
FVTTPEFEDVAIVFDATSAAAHERHASILAQLNKQVVDLTPAAVGPYVIPTVNMDRVVGE
PNVNMVTCGGQATVPIVAAISGVTPVHYAEIVASIASRSAGPGTRANIDEFTETTALALE
SVGGATQGKAIIVLNPAEPPLIMRDTVLCLCDEADETEIEAAVERMVASVAEFVPGYRLK
QKVQFQRYTRNSPLRLPEQEADFTGLQVSVFLEVEGAAHYLPAYAGNLDIMTSAALRTAE
RMTELDAIRGK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggacaaggtgaaggtcgcgatcatcggatccggcaacatcggtaccgacctgatgatg
aagaccctgcgttcttcttcgctcgagatggcggtgctcgtgggggtcgatccgcggtcg
gatggcctggccagggcggagcgactcggaatcgccaccacctccggcggcttggatcat
ttcgtcacgacgcccgaattcgaggatgtggcgatcgtcttcgacgcaacctccgccgcc
gcacacgagcggcacgcatccatcctggcccagctgaacaagcaggtggtcgatctcacg
cctgccgctgtggggccatatgtgattccgacggtcaatatggaccgcgtcgtaggagag
cccaacgtgaacatggtgacctgtggtgggcaggcgaccgtgccgatcgtcgccgcgatt
tccggtgtgacccccgtgcactacgccgagatcgtcgcgtcgatcgcctcgcggtcggcg
ggccccggcaccagggcgaacatcgacgagttcaccgagacaaccgcactggcgctggag
agtgtcggcggcgccactcaaggaaaggcgatcatcgtactgaatccggcggaaccaccc
cttatcatgcgcgacacggtgctctgcctctgtgacgaggcagacgagacggaaatcgag
gccgcggtcgagcggatggtcgcttcggtcgcagagttcgtccctggctaccggctcaag
cagaaggtgcagttccagcggtacacccggaattccccactccgactaccagagcaagag
gctgacttcaccgggctccaggtttcggttttcctcgaggtagaaggggctgcccattac
cttcccgcctacgcgggaaatctcgacatcatgacctccgcagcattgcggaccgcggaa
cgtatgaccgaacttgacgcgattcgggggaagtga

DBGET integrated database retrieval system