KEGG   Mycobacterium smegmatis MC2 155: MSMEI_4182Help
Entry
MSMEI_4182        CDS       T02191                                 

Gene name
sucB
Definition
DlaT, dihydrolipoamide acyltransferase, E2 component of pyruvate dehydrogenase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MSMEI_4182 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MSMEI_4182 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    MSMEI_4182 (sucB)
Enzymes [BR:msg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MSMEI_4182 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4368823..4370580
Genome map
AA seq 585 aa AA seqDB search
MAISVQMPALGESVTEGTVTRWLKQEGDTVELDEPLLEVSTDKVDTEIPSPAAGVLTKIV
AQEDDTVEIGGELAVIGEAGEASAEAPSEDSAPAPEPEPEPEPEPQQTQPTAAPAESVES
APAESSAPSQGGGSATPILMPELGESVTEGTVTRWLKNVGDKVEVDEPIVEVSTDKVDTE
IPSPVAGTLLSITANEDDVVEVGGELAKIGDAGAAAEPKPEPKPEPKAEPKPEPKPEPKP
EPKAEPKPEPKPEPKPEPKAEPAPAASSDGSPYVTPLVRKLAAENGIDLSTVKGTGVGGR
IRKQDVLAAAEKAKEAKQAPAASPAAAAPAAPAAASATPAPALAHLRGTTQKANRIRQIT
AKKTRESLQATAQLTQTHEVDMTKIVALRARAKAEFAEREGVNLTFLPFIARAVIDALKI
HPNVNASYNEDTKEITYYDAEHLGFAVDTDQGLLSPVIHNAGDLSLGGLARAIADIAARA
RSGNLKPDELAGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKRPRVIVDEYGNES
IGVRSVCYLPLTYDHRLIDGADAGRFLTTIKRRLEEGAFEADLGL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggccatctccgtccagatgcccgcactaggtgagagtgtcacagaggggacggtgacc
cgctggctcaagcaggagggcgacaccgtcgaactcgacgagccactgctcgaggtgtcc
accgacaaggtcgacaccgagatcccctccccggccgccggtgtgttgacgaagatcgtc
gcgcaggaggacgacaccgtggagatcggtggcgaactcgcggtgatcggcgaggccggc
gaggcatccgccgaggcaccctctgaagactccgccccggctcccgaacccgagcctgag
cccgaacccgagccccagcagacccagccgaccgcggccccggcggaatccgtcgagtcc
gcgcctgccgaatcgtcggccccgtcgcagggcggcgggtcggccaccccgatcctgatg
cccgagttgggcgagtcggtcaccgagggcaccgtgacccgctggctgaagaacgtcggc
gacaaggtcgaggtcgacgagccgatcgtcgaggtgtccaccgacaaggtcgacaccgag
atcccgtcaccggtggcgggcacgctgctgtcgatcaccgccaacgaggacgacgtcgtc
gaggtcggcggcgagctggcgaagatcggcgacgccggcgcggcggccgagccgaagccc
gagccgaaacccgagcccaaggccgagccgaagcccgaacccaagccggaacccaagccc
gagcccaaggccgaacccaagccggaaccgaagcccgaacccaagcctgagcccaaggcc
gagcccgcccccgcggcgagctccgacggttccccctatgtcactccgctggtgcggaag
ttggccgcggagaacgggatcgacctctccacggtcaagggcaccggtgtcggtggccgc
atccgcaagcaggacgtgctcgcggccgccgagaaggccaaggaggccaagcaggctccg
gcagcctcccccgccgcggcggcgcccgcggccccggctgccgcatcggccacgcctgcc
ccggcgctcgcacacctgcgcggcaccacgcagaaggcgaaccggatccgtcagatcacc
gcgaagaagacgcgtgagtcgctgcaggccaccgcgcagctgacgcagacccacgaggtc
gacatgaccaagatcgtggcgctgcgggcccgcgccaaggccgagttcgccgagcgcgaa
ggcgtcaacctcacgttcctgccgttcatcgcgcgtgcggtgatcgacgcgttgaagatc
caccccaacgtcaacgccagctacaacgaggacaccaaggagatcacctactacgacgcc
gagcacctcggcttcgcggtggacaccgaccagggtctgctgtcgccggtgatccacaac
gccggtgacctctcgctgggcggcctggcgcgcgcgatcgccgatatcgccgcccgcgcc
cggtcgggcaacctcaagcccgatgagctggccggtggcaccttcacgatcaccaacatc
ggcagccagggcgcgctgttcgacaccccgatcctggttccgccgcaggcggcgatgctg
ggcacgggtgccatcgtcaagcggccgcgcgtgatcgtcgacgagtacggcaacgagtcg
atcggtgtccggtcggtgtgctacctgccgctcacctacgaccaccgcctgatcgacggc
gccgacgccggacggttcctgaccacgatcaagcgcaggctcgaagagggcgcgttcgag
gccgacctgggtttgtga

DBGET integrated database retrieval system