KEGG   Mycobacterium smegmatis MC2 155: MSMEI_4270Help
Entry
MSMEI_4270        CDS       T02191                                 

Definition
Agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MSMEI_4270
Enzymes [BR:msg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     MSMEI_4270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4462326..4463285)
Genome map
AA seq 319 aa AA seqDB search
MTNDKSRDAIVVPVDPQVQPRYAGWTTYARLPRLEDVSHADVAVVGVPFDSAVTYRPGAR
FGPNAIRQASRLVRGYNPELDIAPFQVCQFADAGDIACNPFDIGQAVDQVTAELTALLSK
GTRAVVLGGDHSVALPSLRAAHAVHGPVALVHFDAHLDTWDSYYGADLTHGSPFRRAFEE
GLLQETNMHVGVRGSIYDKQDLVEDAKFGFSVITCRDITKLGSDGVIERIRERVGDAPVY
VSVDIDVLDPAHAPGTGTPEAGGMSSRELLEVVRGLDQVNLIGADVVEVSPAYDHAEITA
VAAANVTWELLSVFGRKAR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgacaagagccgcgacgcgatcgtggtgccggtggatccgcaggtgcagccg
cggtacgccggctggacgacctacgcccgtctgccccggctggaggatgtctcccacgcc
gacgtggcggtggtgggcgtgccgttcgacagtgccgtcacctaccggcccggtgcgcgg
ttcggccccaacgcgattcgtcaggcgtcgcggctggtccgcggctacaaccccgaactc
gacatcgccccgttccaggtgtgccagttcgccgacgccggtgacatcgcgtgcaacccg
ttcgacatcggccaggccgtcgatcaggtgaccgcggaactgaccgcgctgctgtccaag
ggcacccgcgcggtggtcctcggtggcgaccactcggtggcgctgccgtcgttgcgcgcc
gcccacgccgtgcacggcccggtggccctggtgcacttcgacgcccacctcgacacctgg
gactcctactacggggccgacctcacccacggctcaccgttccgccgggccttcgaggag
ggcctgctgcaggagacgaacatgcacgtcggcgtgcgcggatccatctacgacaagcag
gatctggtcgaggacgccaagttcggcttctcggtgatcacctgccgcgacatcaccaag
ctcggttccgacggcgtgatcgagcgcatccgcgaacgtgtgggcgacgcaccggtgtac
gtgtcggtggacatcgacgtcctcgatcccgctcatgcccccggcacgggaacgcctgag
gccggcggcatgtcgagccgcgaactgctcgaagtggtgcgtggtctcgatcaggtgaac
ctgatcggcgccgacgtcgtcgaggtgtccccggcctacgaccacgccgagatcaccgcc
gtggccgcggccaacgtgacctgggaactgttgagtgtgttcggaaggaaggcccgctga

DBGET integrated database retrieval system