KEGG   Mycobacterium smegmatis MC2 155: MSMEI_4505Help
Entry
MSMEI_4505        CDS       T02191                                 

Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
msg00330  Arginine and proline metabolism
msg00332  Carbapenem biosynthesis
msg01100  Metabolic pathways
msg01130  Biosynthesis of antibiotics
msg01230  Biosynthesis of amino acids
Module
msg_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MSMEI_4505
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    MSMEI_4505
Enzymes [BR:msg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MSMEI_4505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA ACT_7
Motif
Other DBs
NCBI-ProteinID: AFP40959
UniProt: A0R148
Position
complement(4708056..4709168)
Genome map
AA seq 370 aa AA seqDB search
MSEHREAVRTARSVVVKIGTTALTTPSGVFDANRLASLVEAIEGRMKAGSDVVIVSSGAI
AAGIEPLGLSKRPTDLATKQAAASVGQVALVNAWSAAFAVYNRTVGQVLLTAHDISMRVQ
HNNAQRTLDRLRALHAVAIVNENDTVATNEIRFGDNDRLSALVAHLVGADALILLSDIDG
LYDGDPRKATPDKPARFIPEVAAQGDLDGVVAGRGSSLGTGGMASKLSSALLAADAGVPV
LLAAAADAGRALDDASVGTVFAPRPERMSARKFWMRYAAESAGALTLDDGAVRAVIKQRR
SLLPAGITSVTGRFHGGDVVDLRALDGHTVARGVVAYDQAELASIIGRSTHELPVEMRRP
AVHADDLVRT
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagcaccgcgaggcggtccgtaccgcacgcagtgtcgtcgtcaagatcggaacc
acggccctcaccacaccttcgggtgtcttcgacgccaaccggctcgcaagcctggtcgag
gccatcgagggccgcatgaaagccggctccgacgtcgtcatcgtgtcctctggtgccatc
gccgccggtatcgaacctctcgggttgtccaagcgcccaacggatctcgcgaccaagcag
gccgcggccagtgtgggccaggtggccctggtgaacgcgtggagcgcggcgttcgcggtg
tacaaccgcaccgtcgggcaggtcctgctcactgcgcacgacatctcgatgcgtgtgcag
cacaacaacgcccagcgcaccctcgaccgtctgcgagccctgcacgccgtggcgatcgtc
aacgagaacgacaccgtggccaccaacgagatccgcttcggtgacaacgaccggctctcg
gctttggtggcgcacctggtcggggccgacgcgctgatcctgctgtcggacatcgacggc
ctctacgacggagacccccgcaaggcgacgcccgacaaaccggcccgcttcataccggag
gtcgccgcccaaggtgacctcgatggcgtggtcgcgggccgcggcagcagcctcggcacg
ggcggtatggcatcgaagttgtcgtcagctctgctggccgccgacgcgggtgttcccgtg
ctgctggccgccgcggcggacgccggccgagcgctcgacgatgcgtcggtgggcacggtg
ttcgccccgcgccccgagcgcatgtcggcccgcaagttctggatgcggtacgccgcggag
tcggccggtgcgctcaccctcgacgacggcgcggtgcgcgcggtgatcaagcagcgccgc
tcgctgctgcccgcgggcatcacctcggtgaccggccgcttccacggcggcgacgtggtc
gacctgcgagcgctcgacgggcacaccgtcgcgcgcggcgtggtggcgtacgaccaggcc
gaactcgcctcgatcatcggccgctcgacacacgaactgcccgtcgagatgcgccgtccc
gccgtccacgccgacgacctggtgcgcacctag

DBGET integrated database retrieval system