KEGG   Mycobacterium smegmatis MC2 155: MSMEI_4593Help
Entry
MSMEI_4593        CDS       T02191                                 

Definition
(GenBank) Dihydrolipoamide S-acetyltransferase E2 component PdhC
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
msg00010  Glycolysis / Gluconeogenesis
msg00020  Citrate cycle (TCA cycle)
msg00620  Pyruvate metabolism
msg01100  Metabolic pathways
msg01110  Biosynthesis of secondary metabolites
msg01120  Microbial metabolism in diverse environments
msg01130  Biosynthesis of antibiotics
msg01200  Carbon metabolism
Module
msg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSMEI_4593
   00020 Citrate cycle (TCA cycle)
    MSMEI_4593
   00620 Pyruvate metabolism
    MSMEI_4593
Enzymes [BR:msg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MSMEI_4593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: AFP41044
UniProt: I7GDZ1
Position
complement(4801777..4802997)
Genome map
AA seq 406 aa AA seqDB search
MSTRDFLVPDLGEGLQDATITSWNVDVGDTVELNQTLCTVETNKAEVEIPSPYAGKVEAL
GGAAGDTLAVGSLLVRIATSSDEPVEAQPMNGEVPQRKSVLVGYGADDSMDASRRRTHGP
RARAKPPVRKLAAELNVDLGALDPGSGPDGIITRDDVLAAAGRSPAAQSAGTPQPSQTRD
VRGVQAEMARRMALSRREIPDAHARVDVDCTALLRLRDRIRSAETELPITPFVLTLRLLT
VALRRHVVLNATWMETTGGPQIHQHSAVHLGIGVAAPRGLLVPVVRDAQGMTTRQLAVTV
ARLVESARAGTLSPAELTGSTFTVSNFGALGVDDGVPVINYPEAAILGMGSLRERPVVVD
GAVVARPTMSLTCVFDHRIADGAQAAAFLGELRGLIEEPDLALLDL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacccgggacttcctggtgcccgatctcggtgagggcctccaggacgcgaccatc
accagctggaacgtcgacgtcggcgacaccgtcgagttgaaccagacgctgtgcacggtc
gagaccaacaaggccgaggtcgagatccccagcccgtatgcaggcaaggtggaagcgctc
ggcggcgcggcaggggacacccttgccgtggggtcgttgctggtgcgtatcgccacgtcc
tccgacgagccggtcgaggcgcagccgatgaacggtgaagttccacaacgcaagtcggtg
ctcgtggggtatggcgccgacgactcgatggatgccagccgccgccgcacgcacggtccg
cgagcgcgtgccaagccgcccgtgcgcaagctggccgcggaactcaacgtcgacctgggc
gcgttggacccgggatcgggtcccgacggcatcatcacacgcgacgacgtgctggccgcg
gcgggcagatccccggcagcgcagagcgccggcacccctcagccgtcgcagacccgcgac
gtgcgcggggtgcaggccgagatggcgcgacgaatggcgttgtcgcgccgcgagatcccc
gatgcacacgcacgcgtcgacgtcgactgcaccgcgctgctgcgattgcgtgaccgcatc
cgcagcgccgagaccgagctgcccatcacgccgttcgtgctgacgctgcgcctgctgacc
gtcgcgttgcgccgtcacgtggtactcaacgcgacctggatggagaccaccggcggcccg
cagatccatcaacactcggcggtgcacctggggatcggtgtcgccgcgccgcgcggtctg
ctggtgccagtggtgcgcgatgcgcagggcatgaccacgcggcaactcgcggtcacggtg
gcccggctcgtcgaaagcgcccgcgcgggcacgctgtcgcctgccgaactgacggggtcg
acgttcacggtgtcgaacttcggcgcgctcggcgtcgacgacggcgttccggtgatcaac
taccccgaggccgcgatcctcggcatgggctcgctgcgggagcggcccgtcgtggtcgac
ggagccgtcgtggcccgcccgacgatgtcgctcacctgcgtgttcgaccaccgcatcgcc
gacggggcccaggccgcggcgttcctcggcgaactacgcgggctgatcgaggaacccgac
ctggctctcctcgatctctga

DBGET integrated database retrieval system