KEGG   Mycobacterium smegmatis MC2 155: MSMEI_4790Help
Entry
MSMEI_4790        CDS       T02191                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:msg00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5013439..5015649
Genome map
AA seq 736 aa AA seqDB search
MTRSSNQLTDAHLRPDPSDIHRLLAGEHHDPHSVLGAHEYPGHTVIRAFRPHAVKVTAVI
GGERHVMQHLESGLFAVAVPFTNLIDYRLEIDYPGVGDAVVTHTTADAYRFLPTLGELDL
HLFAEGRHERLWEILGAHRRTFTTADGPVSGVSFAVWAPNAKGVSLIGEFNHWGGNDAPM
RVLGSSGVWELFWPGFPPDGLYKFRVHGADGSVTDRADPMAFATEVPPHTASRVTESTYE
WHDEDWMTRRASLNPVFEPMSTLEVHLLSWRPGLTYRQLATELTEYVVEQGFTHVEMLPV
AEHPFGGSWGYQVTSYYAPTSRLGTPDDFRYLVDALHQAGIGVIVDWVPAHFPKDAWALG
RFDGTALYEHSDPRRGEQLDWGTYVFDFGRPEVRNFLVANALYWLQEFHIDGLRVDAVAS
MLYLDYSRPEGGWTPNQYGGRENLEAVQFLQEMNATVHKVAPGIVTVAEESTSWPGVTRP
TNLGGLGFSMKWNMGWMNDTLAYISRDPIYRSYHHHEMTFSMLYAYSENYVLPISHDEVV
HGKGTLWSRMPGGDHEKAAGLRSLLAYQWAHPGKQLLFMGQEFGQRAEWSEERGLDWYQL
DEQSFSTGVQNLVRDLNAIYRSRPALWSRDTSPEGYSWIDANDSANNVLSFLRFGNDGSM
LACVINFAGSEHSQYRLGLPHAGTWREVLNTDADIYNGSGIGNYGAVEATDEPWHGRPAS
AVMVLPPLSMLWFEPA
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgacgagaagcagcaatcaactcaccgacgcacatctgcggccggacccgtccgacatc
catcgcctgctggccggtgagcaccacgacccgcattccgtgctcggtgcgcacgagtac
cccggccacaccgtgatccgtgccttccgtccgcacgcggtcaaggtcaccgcggtcatc
ggcggtgagcgccacgtgatgcagcatctggaatccgggttgttcgcggtcgcggtgccg
ttcaccaacctcatcgactaccgcctggagatcgactaccccggcgtcggcgacgccgtc
gtcacacacaccacggccgacgcctaccggttcctgccgacgctgggcgagctcgacctg
cacctgttcgccgagggccgccacgagcggctgtgggagatcctcggcgcgcaccggcgc
accttcaccacggccgacggcccggtgtcgggggtgtcgttcgcggtgtgggcgcccaac
gccaagggcgtcagcctgatcggcgagttcaaccactggggcggcaacgacgcccccatg
cgcgtgctcgggtcctcgggtgtctgggagctgttctggccgggcttcccgcccgacggg
ctgtacaagttccgcgtgcacggcgccgacggttcggtgaccgaccgtgccgacccgatg
gcgttcgccaccgaggtcccgccgcacaccgcatcgcgggtcaccgagagcacctacgag
tggcacgacgaggactggatgacgcgccgcgcgagcctcaacccagtcttcgagccgatg
agcacgctcgaggtgcacctgctgtcgtggcggcccgggctcacctatcgccaactcgcc
accgagctcaccgaatacgttgtggaacagggtttcacgcacgtcgagatgctgccggtc
gccgagcatccgttcggcgggtcgtggggctaccaggtcacgtcgtactacgcccccacg
tcgcgcctggggacgcccgacgacttccggtatctggtcgacgcgctgcaccaggcgggg
atcggcgtcatcgtcgactgggtgcccgcgcacttccccaaggacgcctgggcgctcgga
cggttcgacgggaccgcgctctacgagcattccgacccgcgccgcggcgagcaactcgac
tggggcacctacgttttcgacttcggcaggcccgaggtccgcaacttcctggtggccaac
gcactgtactggctgcaggagttccacatcgacggcctgcgggtcgacgccgtggcatcc
atgctgtacctggactattcacgccccgaaggcgggtggacacccaaccagtacggcggc
cgcgagaacctcgaggccgtgcagttcctgcaggagatgaacgccacggtgcacaaggtg
gcgcccggcatcgtgaccgtggccgaggagtccacgtcgtggcccggcgtcaccaggccg
acgaaccttggcggccttggcttctcgatgaagtggaacatgggctggatgaacgacacg
ctggcctacatcagccgtgaccccatctaccgcagctaccaccaccacgagatgacgttc
tcgatgctgtacgcctacagcgagaactacgtgctgcccatcagccacgacgaggtggtg
cacggcaagggcacgctgtggagccgcatgcccggcggcgaccacgagaaggccgcgggc
ctgcgcagcctgctggcctaccagtgggcgcatcccggcaagcaactgctgttcatgggc
caggagttcggccagcgtgccgagtggtccgaggaacgcgggctggactggtaccaactc
gacgagcagagcttctccacgggcgtgcagaacctggtgcgcgacctcaacgccatctac
cgcagccgacccgcgctgtggagccgcgacaccagccccgagggctactcgtggatcgac
gccaacgactcggccaacaacgtgctgagcttcctgcgcttcggcaacgacggttcgatg
ctcgcgtgcgtcatcaacttcgcgggctccgagcacagccagtaccggctgggccttccc
cacgccggcacgtggcgtgaggtgctcaacaccgacgccgacatctacaacggctcgggc
atcggcaactacggtgccgtcgaggccaccgacgaaccctggcacggcaggccggcctcg
gccgtcatggtgctgccgccgctgtcgatgctctggttcgagccggcttag

DBGET integrated database retrieval system