KEGG   Mycobacterium smegmatis MC2 155: MSMEI_5137Help
Entry
MSMEI_5137        CDS       T02191                                 

Gene name
echA9
Definition
(GenBank) Enoyl-CoA hydratase EchA9
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
msg00071  Fatty acid degradation
msg00280  Valine, leucine and isoleucine degradation
msg00281  Geraniol degradation
msg00310  Lysine degradation
msg00360  Phenylalanine metabolism
msg00362  Benzoate degradation
msg00380  Tryptophan metabolism
msg00410  beta-Alanine metabolism
msg00627  Aminobenzoate degradation
msg00640  Propanoate metabolism
msg00650  Butanoate metabolism
msg00903  Limonene and pinene degradation
msg00930  Caprolactam degradation
msg01100  Metabolic pathways
msg01110  Biosynthesis of secondary metabolites
msg01120  Microbial metabolism in diverse environments
msg01130  Biosynthesis of antibiotics
msg01212  Fatty acid metabolism
Module
msg_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MSMEI_5137 (echA9)
   00650 Butanoate metabolism
    MSMEI_5137 (echA9)
  Lipid metabolism
   00071 Fatty acid degradation
    MSMEI_5137 (echA9)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MSMEI_5137 (echA9)
   00310 Lysine degradation
    MSMEI_5137 (echA9)
   00360 Phenylalanine metabolism
    MSMEI_5137 (echA9)
   00380 Tryptophan metabolism
    MSMEI_5137 (echA9)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MSMEI_5137 (echA9)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MSMEI_5137 (echA9)
   00281 Geraniol degradation
    MSMEI_5137 (echA9)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MSMEI_5137 (echA9)
   00627 Aminobenzoate degradation
    MSMEI_5137 (echA9)
   00930 Caprolactam degradation
    MSMEI_5137 (echA9)
Enzymes [BR:msg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MSMEI_5137 (echA9)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1 UDPG_MGDP_dh
Motif
Other DBs
NCBI-ProteinID: AFP41581
UniProt: I7GDU3
Position
5369826..5370872
Genome map
AA seq 348 aa AA seqDB search
MTENEDILVNVRNGVGILTLNRPKAINSLTEAMVAEIGKALHAWENDDSVHTVLLTGAGE
RGLCAGGDVVALYHSAKAGGADARRFWYDEYLVNAYIGNYPKPYVAVMDGIVMGGGVGVA
GHGSIRVVTDTTKMAMPEVGIGFVPDVGGTYLLSRAPGALGLHAALTGAPFSGADAIAMG
FADHYVPHDKLADFIESVVAEGVEQALSAHAVEPPASALMEQRAWIDESYAGATVADILA
ALQNHDAPEARAAADLIATRSPVALAVTLEAVRRAEKLDTLEEALRQEYRISSAAVRSHD
FVEGIRAQLVDKDRNPKWSPASIADVTQADIDAYFVPADPELEFEKEN
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtgacagaaaacgaggacatcctagtaaatgtccgcaacggtgtcggcatcctcacgctg
aaccgccccaaggcgatcaactcgctgaccgaagccatggtcgcggagatcggcaaggca
ctccacgcatgggagaacgacgactccgtccacaccgtgctgctcaccggtgccggtgag
cggggtctgtgtgccggcggcgacgtcgtggcgctctatcacagcgcgaaggccggcggc
gcggacgcgcgccgattctggtacgacgagtacctggtcaacgcctacatcggcaattac
cccaaaccgtacgtcgccgtgatggacggcatcgtgatgggcggtggcgtcggcgtggcc
ggccacggcagcatccgggtggtcaccgacaccaccaagatggcgatgcccgaggtcggc
atcggcttcgttcccgacgtgggcggcacctatctgctctcgcgcgcccccggcgcgctc
ggtctgcacgccgcgctcacgggtgcgccgttctcgggggccgacgcgatcgccatgggc
ttcgccgatcactatgtgccgcacgacaagctcgccgatttcatcgagtccgtcgttgcc
gaaggtgtcgagcaggccctgtccgcgcacgccgttgaaccgccggccagcgccctgatg
gaacagcgggcctggatcgacgagtcctacgcgggcgcgacggtcgccgacatcctcgcg
gcgctgcagaaccacgacgccccggaggccagggccgccgccgatctgatcgccacgcgc
tcccccgtcgcgctggcggtgacgcttgaggcggtgcgccgggccgagaaactggacacc
ctcgaagaggcgctgcgccaggagtaccggatctccagcgccgcggtgagatcgcatgat
ttcgtcgagggcatccgggcccagttggtggacaaggaccgcaacccgaagtggtcaccc
gcctcgatcgccgatgtcacccaggccgacatcgacgcctatttcgttccggcggacccg
gaactggagttcgagaaggagaactga

DBGET integrated database retrieval system