KEGG   Mycobacterium smegmatis MC2 155: MSMEI_5321Help
Entry
MSMEI_5321        CDS       T02191                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MSMEI_5321 (galU)
   00052 Galactose metabolism
    MSMEI_5321 (galU)
   00500 Starch and sucrose metabolism
    MSMEI_5321 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    MSMEI_5321 (galU)
Enzymes [BR:msg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MSMEI_5321 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5555155..5556078)
Genome map
AA seq 307 aa AA seqDB search
MSTPSKAPTVSIPHTAVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAEAGAE
RLVIVTSEGKDGVVAHFVQDLVLEGTLEARGKKTMLEKVRRAPALIKVESVVQAEPLGLG
HAVSCVESVLAADEDAISVLLPDDLVLPTGVLETMSKVRAKRGGSVLCAIEVPGDKISAY
GVFDVETVPDAANPNVLRVKGMVEKPRPEDAPSHFAAAGRYVLDRAIFDALRRVPRGTGG
EIQLTDAIALLIEEDHPVHVVVHRGARHDLGNPGGYLKAAVDFALERDDYGPELRQWLVE
RLGLAEK
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgccttcgaaagcccctacggtgtcgattcctcataccgcagtcgtcccggcg
gccggtctgggaactcgtttcctgccggcaaccaagactgtgcccaaagaactgttgccg
gtcgtcgacacgcccggtatcgaactcgtcgcggcagaggccgccgaggccggcgcggag
cgcctggtcatcgtcacgtccgagggcaaggacggtgtcgtcgcgcacttcgtccaagac
ctggtgctggagggcaccctggaagctcgcggcaagaagaccatgttggagaaggtccgg
cgcgcgcctgccctgatcaaggtcgaatcggtggtgcaggccgagccgctgggcctcggc
cacgccgtgagctgcgtcgagtccgtcctggctgccgacgaggacgccatctcggtgctg
ctgcccgacgacctggtgttgcccaccggcgtgttggagaccatgtcgaaggtgcgggcc
aagcgcggcggctcggtgctgtgcgcgatcgaggtgcccggcgacaagatcagcgcctac
ggtgtcttcgacgtcgaaaccgtgcccgacgccgccaacccgaacgtgctgcgggtcaag
ggcatggtcgagaagcccaggcccgaggacgcgccgtcgcacttcgccgcggccggccgt
tacgtgctggaccgcgcgatcttcgacgcgctgcgccgcgttccccgcggtaccggtggc
gagatccagctgaccgacgccatcgcgttgctgatcgaagaggaccatcccgtgcacgtg
gtggtgcaccgcggtgctcgacacgacctgggaaatcccggcggctacctgaaggctgcg
gttgactttgcgttggaacgtgacgactacggcccagaactgcggcagtggttggttgag
cgactgggcttggcagagaagtga

DBGET integrated database retrieval system