KEGG   Mycobacterium smegmatis MC2 155: MSMEI_5360Help
Entry
MSMEI_5360        CDS       T02191                                 

Definition
Magnesium chelatase subunit ChlI (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MSMEI_5360
Enzymes [BR:msg01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     MSMEI_5360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5600258..5601640)
Genome map
AA seq 460 aa AA seqDB search
MSQPKDLPRTVGELRASGHRERGVKAEIRENLLAALAERRDVWPGILGFEDTVIPQLERA
LIAGHDVVLLGERGQGKTRLLRALTGLLDEWTPVIAGSELGEHPYSPITPESIRRAADSG
DDLPVEWRHRSERYTEKLATPDTSVADLVGDIDPIKVAEGRSLGDPETIAYGLIPRAHRG
IVAVNELPDLAERIQVAMLNVMEERDIQVRGYTLRLPLDVLVVASANPEDYTNRGRIITP
LKDRFGAEIRTHYPLELEAEVGVIRQEAELAAEVPEYLLAVLARFARNLRESNSIDQRSG
VSARFAIAAAETVAASARHRAAILGEDDPVARVVDLGTVIDVLRGKLEFETGEEGREQAV
LEHLLRRATADTAQRLLGGIDVGPLVAAIEEGSPVTTGERVSAKDVVAALPDLPAIDAIA
HRLNAVSVGQRAAAIELALEALYLAKRIDKVSGEGETVYG
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcaaccgaaggatctgccccgcacggtcggtgaactgcgagcttccgggcaccgc
gaacggggtgtgaaagccgaaatccgggaaaacctgctggccgcgctggccgagcgccgc
gatgtttggcctgggattctcggcttcgaggacaccgtgatcccgcagctcgaacgggcc
ctgatcgccgggcacgacgtggtgttgctgggcgagcgcggtcagggcaagaccaggctg
ctgcgggcgctgaccgggctgctcgacgagtggacacccgtgatcgcgggttccgaactg
ggcgagcatccctacagccccatcacgccggagtcgatccgccgtgcggccgactccggt
gacgacctgcccgtcgagtggcgtcatcgcagcgagcgctacaccgagaaactcgcgacg
cccgacaccagcgtcgccgacctggtgggcgacatcgacccgatcaaggtcgccgaaggg
cgcagcctgggtgaccccgagaccatcgcctacgggctcatcccgcgggcgcaccgcggc
atcgtggcggtcaacgaacttcccgacctcgccgagcgcatccaggtggcgatgctcaac
gtgatggaggagcgcgacatccaggtgcgcggctacacgctgcggctgccgctcgacgtg
ctcgtcgtcgccagcgccaacccggaggactacaccaaccgcgggcgcatcatcaccccg
ctcaaggaccggttcggcgccgagatccgcacgcactacccgctggaactcgaggccgag
gtgggcgtcatccggcaggaggccgaactcgcggccgaggtgcccgagtacctgctcgcc
gtgctcgcccggttcgcgcgcaatctccgtgagtcgaactcgatcgaccagcgttcgggt
gtgtcggcgcggttcgcgatcgccgcggccgagaccgtcgcggcctcggcgcggcaccgc
gcggccatcctcggtgaggacgatccggtggcccgtgtggtcgacctcgggaccgtgatc
gacgtgttgcgcggcaaactcgaattcgagaccggcgaagaaggtcgggagcaggccgtg
ctggagcatctgctgcgccgcgccacggccgacaccgcgcagcgcctgctgggcggtatc
gacgtcggcccgctcgtcgcggcgatcgaggaaggctccccggtgaccaccggtgagcgc
gtctccgccaaagacgttgtggcggcgctgccggacctgcccgccatcgacgccatcgcg
caccgcctcaacgcggtgtcggtgggccagcgtgccgccgcgatcgaattggcgctggag
gcgctgtatctggcgaaacggatcgacaaggtgtccggggagggcgagaccgtctatggc
tga

DBGET integrated database retrieval system