KEGG   Mycobacterium smegmatis MC2 155: MSMEI_5373Help
Entry
MSMEI_5373        CDS       T02191                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA ligase ADP-forming subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MSMEI_5373 (sucC)
   00640 Propanoate metabolism
    MSMEI_5373 (sucC)
   00660 C5-Branched dibasic acid metabolism
    MSMEI_5373 (sucC)
Enzymes [BR:msg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MSMEI_5373 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5616465..5617628)
Genome map
AA seq 387 aa AA seqDB search
MDLFEYQAKELFAKHNVPTSPGRVTDSAEDAKTIAEEIGRPVMVKAQVKTGGRGKAGGVK
YAATPDDAFTHANNILGLDIKGHVVKKLLVAEASDIAEEYYISFLLDRANRTYLAMCSVE
GGMEIEEVAATKPERLAKVPVDAVKGVDLAFARSIAEQGHLPAEVLDAAAVTIQKLWEVF
VKEDATLVEVNPLVRTPDDQILALDGKVTLDENAGFRQPGHAEFEDRDATDPLELKAKEN
DLNYVKLDGQVGIIGNGAGLVMSTLDVVAYAGENHGGVKPANFLDIGGGASAAVMAAGLD
VILGDSQVKSVFVNVFGGITACDAVANGIVQALQILGDEANKPLVVRLDGNNVEEGRRIL
AEANHPLVIQAETMDAGADKAAELANK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggatctcttcgaataccaggcgaaagagctgttcgccaagcacaacgtcccgacatca
cccggccgggtgaccgattccgccgaggacgccaagacgatcgccgaggaaatcggccgc
cccgtgatggtgaaagcccaggtcaagaccggtggtcgcggcaaggccggtggcgtgaag
tacgcagccacccccgatgacgcgttcactcacgcaaacaacatcctcggcctcgacatc
aagggccacgtggtcaagaagttgctcgtggccgaggcgagcgacatcgccgaggagtac
tacatctccttcttgctcgatcgcgccaaccgcacctacctggccatgtgctcggtcgag
ggtggcatggagatcgaggaagtggccgccaccaagcccgagcgtctcgcgaaggttcct
gtcgacgccgtcaagggtgtcgacctggcgttcgcccgttcgatcgccgagcaaggccac
ctgcccgccgaggtgctcgacgccgccgcggtgaccatccagaagctgtgggaggtgttc
gtcaaggaggacgccaccctggtggaggtcaacccgctggtgcgcacccccgacgatcag
atcctcgccctcgacggcaaggtcaccctcgacgagaacgccggcttccgtcagcccggc
cacgccgagttcgaggaccgcgacgccaccgatcctcttgagctcaaggccaaggagaac
gacctcaactacgtcaagctcgacgggcaggtcggcatcatcggcaacggcgccggtctg
gtcatgtcgacgctggacgtcgtcgcctacgcgggtgagaaccacggcggcgtgaagccc
gccaacttcctggacatcggcggtggcgcctcggccgccgtgatggccgcgggtctggac
gtcattctgggcgacagccaggtcaagagcgtgttcgtcaacgtcttcggtggcatcacc
gcgtgtgacgccgtcgccaacggcatcgtgcaggccctgcagatcctgggcgacgaggcc
aacaagccgctggtcgtgcgtctggacggcaacaacgtcgaagagggccggcgcatcctg
gccgaagccaaccaccccctggtcatccaggccgagaccatggacgccggtgccgacaag
gccgccgagctggcgaacaagtaa

DBGET integrated database retrieval system