KEGG   Mycobacterium smegmatis MC2 155: MSMEI_5398Help
Entry
MSMEI_5398        CDS       T02191                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:msg00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MSMEI_5398
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    MSMEI_5398
Enzymes [BR:msg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     MSMEI_5398
Two-component system [BR:msg02022]
 CheA family
  CheA-CheYBV
   MSMEI_5398
Bacterial motility proteins [BR:msg02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    MSMEI_5398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5641442..5642086
Genome map
AA seq 214 aa AA seqDB search
MIGVLLSGVLDDGVLGAAAIKRRGGLVIAQSPTDALFPAMPTNAMHAGVVDHVADAADMG
GLIKQLSERTIEERDMEPDDSMELENRIAMAGRFSTDFDSEALGPPSGYICPDCNGSLST
VSEGNFRCRVGHAWTADALLRARDQEVEGALWVALRSLEEKAKLSRKLAEKAGAGLMARR
YEELATEAEHAVSVLSERLAEVGRQVGDLGDQIT
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gtgatcggcgtcctgttgtcgggggtgctcgacgacggtgttctcggtgccgcggccatc
aagagacgcggcgggctggtgatcgcgcagtcgccgacagacgcgctgttccccgcgatg
ccgacgaacgccatgcatgccggggtggtcgaccatgttgcggacgcggccgacatgggt
gggctgataaagcagctgagcgagcggacgatcgaggagcgcgacatggagcccgacgat
tccatggaactggagaaccgcatcgccatggccggcaggttctcgaccgatttcgattcc
gaggcgctcggtcccccctccggttacatctgcccggactgcaacgggtcactgtcgacc
gtcagcgagggcaacttccgctgccgcgtggggcacgcctggaccgcggacgcgctgctg
cgggcgcgggaccaggaggtcgagggcgcgctgtgggtcgcgctgcgcagcctggaggag
aaggcgaagctgtcgaggaagctcgcggagaaggccggcgcagggctgatggcgcggcgg
tatgaagaactcgccacagaggccgagcacgcggtgtcggtgctcagtgaacggctggcg
gaggtgggcaggcaagtgggggacctcggtgaccagatcacgtag

DBGET integrated database retrieval system