KEGG   Mycobacterium smegmatis MC2 155: MSMEI_5398Help
Entry
MSMEI_5398        CDS       T02191                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:msg02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:msg02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5641442..5642086
Genome map
AA seq 214 aa AA seqDB search
MIGVLLSGVLDDGVLGAAAIKRRGGLVIAQSPTDALFPAMPTNAMHAGVVDHVADAADMG
GLIKQLSERTIEERDMEPDDSMELENRIAMAGRFSTDFDSEALGPPSGYICPDCNGSLST
VSEGNFRCRVGHAWTADALLRARDQEVEGALWVALRSLEEKAKLSRKLAEKAGAGLMARR
YEELATEAEHAVSVLSERLAEVGRQVGDLGDQIT
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gtgatcggcgtcctgttgtcgggggtgctcgacgacggtgttctcggtgccgcggccatc
aagagacgcggcgggctggtgatcgcgcagtcgccgacagacgcgctgttccccgcgatg
ccgacgaacgccatgcatgccggggtggtcgaccatgttgcggacgcggccgacatgggt
gggctgataaagcagctgagcgagcggacgatcgaggagcgcgacatggagcccgacgat
tccatggaactggagaaccgcatcgccatggccggcaggttctcgaccgatttcgattcc
gaggcgctcggtcccccctccggttacatctgcccggactgcaacgggtcactgtcgacc
gtcagcgagggcaacttccgctgccgcgtggggcacgcctggaccgcggacgcgctgctg
cgggcgcgggaccaggaggtcgagggcgcgctgtgggtcgcgctgcgcagcctggaggag
aaggcgaagctgtcgaggaagctcgcggagaaggccggcgcagggctgatggcgcggcgg
tatgaagaactcgccacagaggccgagcacgcggtgtcggtgctcagtgaacggctggcg
gaggtgggcaggcaagtgggggacctcggtgaccagatcacgtag

DBGET integrated database retrieval system