KEGG   Mycobacterium smegmatis MC2 155: MSMEI_5400Help
Entry
MSMEI_5400        CDS       T02191                                 

Definition
hypothetical protein
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:msg00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MSMEI_5400
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    MSMEI_5400
Enzymes [BR:msg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     MSMEI_5400
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     MSMEI_5400
Two-component system [BR:msg02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   MSMEI_5400
Bacterial motility proteins [BR:msg02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    MSMEI_5400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5642768..5644729
Genome map
AA seq 653 aa AA seqDB search
MHTDHDRKNGLGADRSRELLLTASKVTVATHRGRWDEMEQADESFEALLRYMRDSRGFDF
TGYKRTSLMRRVRHRMDQAGHDTFEEYLDVLQASSDEFSALFNTILINVTAFFRDPEAWE
FIRSDVIPRMLAERGPDDPIRVWSAGCASGQEAYTLAMLLAEALGPDAFRQRVKIYATDV
DEDALTEARAASYDARAVESVPPTLLSTYFEHVNGRYIFHKDLRRAVIFGRNDLVKDAPI
SRVDLLVCRNTLMYLNAETQRNVISRLHFALGAQGTLFLGHAEMLLSHADRFAPLNLKHR
IFRKAAGSHSGIERYDPTAARYDRHGDLPGLTTVRDLAFRASPVAQIVVTGEDTVAMINQ
QAESIFGLSARDIGRLLRDLEISYRPVELRAYIEQCKVERRSARIQDVKWQRPGSETVWF
EIHVNPLVDNENGLLGVSIVFFDVSATRALVDKVVQTNRQLEAAYEELQSTNEELETTNE
ELQSTVEELETTNEELQSTNEELETMNEELQSTNDELHTINDTLRDRSIELEDARTFLDS
MVNSIQLGMVVVDREMHVVVWNRHCEDLWGLRADETVGTPLTSLDIGLPLDQVRPLIGNA
FVDAGDPGEVVVDAVNRRGRAARIRVTCAPFRSPEGGVKGALLLMEDQLAAHS
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
ttgcacaccgaccacgaccggaaaaacggtttgggcgctgatcggtcccgagagttgctt
ctgaccgctagtaaggtcacagtcgcgacacaccgcgggcgatgggatgagatggaacag
gccgacgaatcgttcgaagcactgctgcgctacatgcgtgactcgcgtgggttcgacttc
accggttacaaacgcacatcgttgatgcgccgcgtgcggcaccgcatggaccaggcgggt
cacgacacgttcgaggaatacctcgacgtgttgcaggccagttccgacgagttctcggcg
ctgttcaacacgatcctcatcaacgtcacggcgttcttccgcgatccggaggcgtgggag
ttcatccgcagtgacgtgatcccgcgcatgctcgccgaacgcggacccgacgaccccatc
cgggtctggagcgccggttgcgcgtccgggcaggaggcgtacacgctggcgatgctgctc
gccgaggcgctgggacccgacgccttccgtcaacgcgtcaagatctacgccaccgatgtc
gacgaggacgcgctcaccgaggcacgcgccgcctcgtacgacgcgagagccgtcgaatcg
gtgccgccgacgctgttgtcgacgtacttcgaacatgtcaacggccgctacatctttcac
aaggacctgcgacgcgcggtgatcttcggccgcaacgatctggtgaaggacgcgcctatc
tcgcgggtcgaccttctcgtgtgccgcaacacgctgatgtatctcaatgccgagacacag
cgaaacgtcatcagccgcttgcactttgcgctcggggcacaggggacgctgttcctcggc
cacgccgagatgctgctgagccatgccgaccggttcgcgccgctgaacctcaagcaccgg
atcttccgcaaggccgcggggtcgcattcaggcatcgaacgttacgacccgaccgccgcg
aggtacgaccgtcacggcgacctgcccgggctcaccacggtgcgggacctggccttccgc
gccagccctgtcgcgcagatcgtggtgaccggcgaggacaccgtcgcgatgatcaaccag
caggccgagtccattttcgggctctcggcccgagacatcgggcgtctgctgcgcgacctc
gagatctcctaccggccggtcgaactgcgcgcctacatcgagcagtgcaaggtcgagcgc
cgatccgctcgcatccaggacgtgaagtggcagcgtcctggctcggagaccgtgtggttc
gagattcacgtgaacccactcgtggacaacgagaacggcttgctcggtgtgtccatcgtg
ttcttcgacgtctcggccacccgcgcgctggtcgacaaggttgtccagaccaaccgccag
ctcgaggcggcctacgaggaacttcagtccaccaacgaagagcttgagaccaccaacgag
gaacttcagtcgacggtggaggaactggagaccaccaacgaggaactccagtccaccaac
gaagaactcgagaccatgaacgaggagttgcagtccaccaacgacgaactgcacaccatc
aacgacacgctgcgtgaccgcagcatcgaactcgaggacgcacggaccttcctcgattcg
atggtgaactcgatccagctggggatggtggtcgtcgaccgcgagatgcacgtggtggtg
tggaaccggcactgcgaggacctgtggggtctgcgcgccgacgagaccgtgggaaccccg
ttgacgtcgctggacatcggcctgccgctcgatcaggtgcggccgctgatcgggaacgcc
ttcgtcgacgccggcgacccgggcgaggtcgtcgtcgatgcggtcaaccggcgcggacgt
gccgcgcgcatccgggtcacgtgcgcgccgttccggtcccccgagggcggcgtgaagggt
gccttgttgttgatggaggaccagctcgcggcgcactcctag

DBGET integrated database retrieval system