KEGG   Mycobacterium smegmatis MC2 155: MSMEI_5500Help
Entry
MSMEI_5500        CDS       T02191                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
msg00010  Glycolysis / Gluconeogenesis
msg00620  Pyruvate metabolism
msg00640  Propanoate metabolism
msg00680  Methane metabolism
msg01100  Metabolic pathways
msg01110  Biosynthesis of secondary metabolites
msg01120  Microbial metabolism in diverse environments
msg01130  Biosynthesis of antibiotics
msg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSMEI_5500
   00620 Pyruvate metabolism
    MSMEI_5500
   00640 Propanoate metabolism
    MSMEI_5500
  Energy metabolism
   00680 Methane metabolism
    MSMEI_5500
Enzymes [BR:msg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MSMEI_5500
Lipid biosynthesis proteins [BR:msg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MSMEI_5500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AFP41940
UniProt: I7FKX6
Position
complement(5740668..5742356)
Genome map
AA seq 562 aa AA seqDB search
MSGNADLYRSARDQLVATIADYDKAVETFAFPELTGTFNWAIDWFDAIARGNDRPALWIV
EEDGAETQVSFADMAERSDRVATWLAALGVGKGDRVILMLGNQVELWEAMLGIAKLGAVI
MPTTGALGPADLADRIARGGARFVIANASDTDKFAAVEGDYGRIVVGEAVEGWHAYSDAS
EVQPQRFASATTVDDTMLIYFTSGTTSKPKLVEHSQVSYPVGHLSTMAWIGVKPGDVHLA
ISSPGWAKHAWSCFFAPWIAEATIFVYNYRRFDAPALLNQLRRAKVNTFCAPPTVWRMLI
QADLGARPEGLREILGAGEPLNPDVIAQVEKAWGLTIRDGFGQTETTLQVGNTPGQPVKP
GSMGRPMPGVPVVLVDPITGEPADEGEICLDLSKRPRNLMTGYLGDPQRNEAVMAGGYYH
TGDVASRDADGYITYIGRTDDVFKSSDYKVSPFELESVLIEHPAVVEAAVVPQPDDTRLA
VPKAYVALAEGWEPNADTAKAVMEYARDHLAPYLKVRRVEFFDLPKTISGKIRRVELRKR
EDEAHQTGKEIPTEYRYEDLLG
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgagtggtaacgccgatctctaccgtagtgcccgtgatcagctcgtcgcgaccatcgcc
gactatgacaaggccgtcgagacattcgcgtttccggagctgaccggcactttcaactgg
gcgatcgactggttcgacgcgatcgccaggggcaacgaccgtcccgcgctgtggatcgtg
gaggaggacggcgccgagacgcaggtgagtttcgccgacatggcggagcgctccgaccgg
gtcgcgacgtggttggcggctctcggcgtcggcaagggcgaccgggtgatcctcatgctc
ggcaaccaggtcgagttgtgggaggcgatgctcggcatcgccaagctcggcgcggtcatc
atgccgaccaccggggcgctcggcccggccgatctggcggaccgcatcgcgcgcggcggc
gcgcggttcgtgatcgcgaacgcgtccgacaccgacaagttcgcggcggtcgaaggtgac
tacgggcggatcgtggtgggcgaggccgtggagggctggcacgcctactccgacgcgtcc
gaggtgcagccgcagcggttcgccagtgccaccacggtcgacgacaccatgctcatctac
ttcacctccggcaccaccagcaagcccaagctggtcgagcattcgcaggtcagctacccc
gtcgggcatctgtcgacgatggcgtggatcggcgtgaagcccggcgacgtgcacctggcg
atcagctcgcccggctgggccaaacacgcgtggagctgctttttcgcgccgtggatcgcc
gaggcgacgatcttcgtctacaactaccgccgcttcgacgccccggcgctgctgaaccag
ctgcgccgcgccaaagtcaacacgttctgcgcaccgcccacggtgtggcgcatgctgatc
caggccgacctgggcgccaggcccgaggggctgcgcgagatcctcggcgccggtgagccg
ctcaaccccgatgtgatcgcccaggtcgagaaggcctgggggctgaccatccgcgacggg
ttcggccagaccgagaccaccctgcaggtcggcaacaccccagggcagccggtgaagccg
ggctcgatgggcaggcccatgcccggtgtgccggtggtgctggtcgacccgatcaccggc
gagcccgccgacgagggcgagatctgcctggacctgagcaagcgtccgcgcaacctcatg
accggctacctcggcgatccgcaacgcaacgaggccgtgatggcgggcggttactaccac
acgggcgacgtcgcgtcgcgcgacgccgacggctacatcacctacatcgggcgcaccgac
gacgtgttcaagtccagcgactacaaggtgtcgccgttcgagctcgagagcgtgctcatc
gagcatcccgccgtggtcgaggccgccgtggtgccccagcccgacgacacgcgcctggct
gtgcccaaggcgtacgtcgcgctggccgaagggtgggaacccaacgccgacaccgcgaaa
gcggtcatggagtacgcgcgtgatcacctggcgccgtacctcaaggtgcgacgcgtcgag
ttcttcgacctgcccaagaccatctccggcaagatccgtcgcgtcgaactgcgcaagcgc
gaggacgaggcacatcagacgggcaaggagattcctaccgaataccgatacgaggatctg
ctgggatga

DBGET integrated database retrieval system