KEGG   Mycobacterium smegmatis MC2 155: MSMEI_5568Help
Entry
MSMEI_5568        CDS       T02191                                 

Gene name
fadB
Definition
(GenBank) Enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
msg00071  Fatty acid degradation
msg00280  Valine, leucine and isoleucine degradation
msg00281  Geraniol degradation
msg00310  Lysine degradation
msg00362  Benzoate degradation
msg00380  Tryptophan metabolism
msg00410  beta-Alanine metabolism
msg00640  Propanoate metabolism
msg00650  Butanoate metabolism
msg00903  Limonene and pinene degradation
msg00930  Caprolactam degradation
msg01040  Biosynthesis of unsaturated fatty acids
msg01100  Metabolic pathways
msg01110  Biosynthesis of secondary metabolites
msg01120  Microbial metabolism in diverse environments
msg01130  Biosynthesis of antibiotics
msg01200  Carbon metabolism
msg01212  Fatty acid metabolism
Module
msg_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MSMEI_5568 (fadB)
   00650 Butanoate metabolism
    MSMEI_5568 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    MSMEI_5568 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    MSMEI_5568 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MSMEI_5568 (fadB)
   00310 Lysine degradation
    MSMEI_5568 (fadB)
   00380 Tryptophan metabolism
    MSMEI_5568 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MSMEI_5568 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MSMEI_5568 (fadB)
   00281 Geraniol degradation
    MSMEI_5568 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MSMEI_5568 (fadB)
   00930 Caprolactam degradation
    MSMEI_5568 (fadB)
Enzymes [BR:msg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     MSMEI_5568 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MSMEI_5568 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     MSMEI_5568 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AFP42008
UniProt: I7FT13
Position
complement(5804776..5806938)
Genome map
AA seq 720 aa AA seqDB search
MAENTIKWDKDADGIVTLTLDDPTGSANVMNEHYKESMHNAVERLAAEKDSITGVVITSA
KKTFFAGGDLKGMMKVGPENAAESFAEVEFIKADLRKLETLGVPVVAAINGAALGGGLEI
ALACHHRIAADVKGVVIGLPEVTLGLLPGGGGVARTVRMFGIQKAFMEVLSQGTRFKPGK
ALEVGLVDQLVSSVDELVPAAKAWITEELKANPETVAVQPWDRKGYKMPGGTPSSPALAS
ILPSFPALLRKQLKGAPMPAPRAILAAAVEGAQVDFDTATRIESRYFVSLVTGQTAKNMI
QAFFLDMQTINGGGSRPDGIAKQEIKKVGVLGAGMMGAGIAYVSARAGFEVVLKDVTLEA
AERGKGYSEKIEAKALERGRTTKEKSDALLARITPTADAADLKGVDFVIEAVFENQELKH
KVFQEIEDIVEPNAILGSNTSTLPITGLATGVKRQEDFIGIHFFSPVDKMPLVEIIKGEK
TSDEALARVFDYTLAIGKTPIVVNDSRGFFTSRVIGTFVNEALAMLGEGVPAASIEQAGS
QAGYPAPPLQLSDELNLELMQKIATETRKAAEATGATYEPHPAEAVVNKMIEIGRPSRLK
GAGFYEYVDGKRVGLWPGLADTFGSGKVDIPLQDMIDRMLFAEALETQKCIDEGVLTSTA
DANIGSIMGIGFPPYTGGSAQFIVGYQGELGVGKEAFVARAKQLAERYGERFNPPASLES
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaacaccatcaagtgggacaaggatgccgacggcatcgtcacgctgacgctc
gacgacccgaccggctcggccaacgtgatgaacgagcactacaaggaatccatgcacaac
gccgtggaacgccttgccgcagagaaggattcaatcaccggtgtcgtcatcaccagcgcg
aagaagacattcttcgccggtggtgacctcaagggcatgatgaaggtcggccctgagaac
gcggccgagtccttcgccgaggtcgagttcatcaaggctgatttgcgcaagctcgagacc
ctgggcgtgcccgtggtggccgccatcaacggcgccgcgctcggcggcggcctggagatc
gcactggcgtgccatcaccgcatcgccgccgacgtcaagggcgtggtgatcggtctgccc
gaggtcaccctcggcctgctgcccggcggcggcggtgtcgcccgcaccgtccggatgttc
ggcatccagaaggccttcatggaggtgctctcgcagggcacccggttcaagccgggcaag
gccctggaagtcgggcttgtggatcagctcgtctcgtcggtggatgagctcgtgcccgcc
gccaaggcttggatcacagaagagctcaaggccaaccccgagacggttgccgttcagccg
tgggatcggaagggctacaagatgcccggcggcaccccgtccagccccgcgctggcgagc
atcctcccgtcgttcccggctctgctgcgcaagcagctcaagggtgcgccgatgcctgcg
ccgcgggccatcctggccgcggcggtcgagggtgcgcaggtcgacttcgacaccgccacc
cgtatcgagagccgctacttcgtcagcctcgtcaccggccagaccgccaagaacatgatc
caggcgttcttccttgacatgcagaccatcaacggtggtggttcgcggcccgacggcatc
gccaagcaggagatcaagaaggtcggtgtccttggtgcgggcatgatgggcgccggtatc
gcctacgtgtcggccagggccggcttcgaggtcgtgctcaaggacgtcacgctggaggcg
gccgagcggggcaagggctactccgagaagatcgaagccaaggcgctcgagcgtggcagg
accaccaaggaaaagtccgacgcgctgctggcccggatcaccccgaccgccgacgcggcc
gacctcaagggtgtggacttcgtcatcgaggccgtcttcgagaatcaggaactcaagcac
aaggtgttccaggagatcgaggacatcgtcgagcccaacgcgatcctcggctcgaacacc
tccacgctgccgatcaccggtctggcgaccggtgtgaagcgccaggaggacttcatcggc
atccacttcttctctccggtcgacaagatgccgctggtggagatcatcaagggcgagaag
acctccgacgaggcgctggcccgggtgttcgactacacgctggccatcggcaagacgccg
atcgtggtcaacgacagccgcggcttcttcaccagccgcgtcatcggcaccttcgtcaac
gaagccctggcgatgctcggtgagggcgtgcccgcggccagcatcgagcaggcgggttca
caggccggctacccggctccgccgctgcagctgtccgacgagctcaacctcgagctgatg
cagaagatcgcgaccgagacccgcaaggccgccgaggccacgggcgccacctatgagccg
catccggccgaagcggtggtgaacaagatgatcgagatcggtcgtccgtcgcgtctgaag
ggcgccggcttctacgaatatgtcgacggcaagcgcgtcggcctgtggccgggtctggcc
gacacgttcggctcgggcaaggtcgacatccccctgcaggacatgatcgaccgcatgctg
ttcgccgaggcgctggagacccagaagtgcatcgacgaaggtgtgctgacatcgaccgct
gacgccaacatcggctcgatcatgggtatcggcttcccgccgtacaccggcggcagtgcg
cagttcatcgtgggctaccagggtgagctgggtgtcggcaaggaggctttcgtggcccgc
gccaagcagctggccgagcgctacggcgagcggttcaacccgcctgcctcgctggagtcc
tga

DBGET integrated database retrieval system