KEGG   Mycobacterium smegmatis MC2 155: MSMEI_5727Help
Entry
MSMEI_5727        CDS       T02191                                 

Gene name
echA13
Definition
(RefSeq) enoyl-CoA hydratase echA13 (EC:4.2.1.17)
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MSMEI_5727 (echA13)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MSMEI_5727 (echA13)
   00650 Butanoate metabolism
    MSMEI_5727 (echA13)
  Lipid metabolism
   00071 Fatty acid degradation
    MSMEI_5727 (echA13)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MSMEI_5727 (echA13)
   00310 Lysine degradation
    MSMEI_5727 (echA13)
   00360 Phenylalanine metabolism
    MSMEI_5727 (echA13)
   00380 Tryptophan metabolism
    MSMEI_5727 (echA13)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MSMEI_5727 (echA13)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MSMEI_5727 (echA13)
   00281 Geraniol degradation
    MSMEI_5727 (echA13)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MSMEI_5727 (echA13)
   00627 Aminobenzoate degradation
    MSMEI_5727 (echA13)
   00930 Caprolactam degradation
    MSMEI_5727 (echA13)
Enzymes [BR:msg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MSMEI_5727 (echA13)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5949275..5950207)
Genome map
AA seq 310 aa AA seqDB search
MRWFDMTGSDGDGGQARQIEYETLDEGRIARIWLNRPQAQNAQSRTLLVQLDEAFARAEA
DDTVRVVILAARGKNFSAGHDLGSEEALAEREPGPGQHPTFAGYGATVAGVAERTYRQEW
HFYFENTKRWRDLRKITIAQVQGNAISAALMLIWACDLIVAADDARFSDVVAVRMGMPGV
EYYAHPWEFGPRKAKELLLTGDSIDADEAYRLGMVSKVFGREELEDKTLEFARRIAERPT
MAALLVKDSVNAAADSMGFAEALHHAFHIHELGHAHWAAANENRWPVGMPPDVPDWRTLG
APKLARRDTP
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggttcgacatgaccggttccgacggcgacggcggccaggcccgccagatcgag
tacgagacgctcgacgaagggcgtatcgcccggatctggctcaaccgcccgcaggcgcag
aatgcgcagtcccgcacgcttctcgtgcaactcgacgaggcgttcgcccgcgccgaggcc
gacgacaccgtgcgcgtggtcatcctggccgcgcgcggcaagaatttctcggccggccac
gacctcggttccgaggaggcactcgccgaacgcgaacccggccccgggcagcacccgacg
ttcgccggctacggcgcgacggtggccggcgtcgccgagcgcacctaccggcaggaatgg
cacttctatttcgagaacaccaaacgctggcgcgatctgcgcaagatcaccatcgcccag
gtgcagggcaacgccatctcggcggccctgatgctgatctgggcgtgcgatctgatcgtg
gccgccgacgacgccaggttcagcgacgtggtggccgtccggatgggcatgcccggcgtc
gagtactacgcgcacccttgggaattcggcccgcgcaaggccaaagaactgctgctgacc
ggcgattcgatcgacgccgacgaggcctaccggctgggcatggtgtccaaggtgttcggc
cgcgaagagctggaggacaagaccctggagttcgcgcggcggatcgccgaacggcccacg
atggctgcgctgctggtgaaggattcggtgaacgccgctgccgactcgatgggcttcgcc
gaggcgttgcaccacgcgttccacatccacgaactcgggcatgcgcactgggccgccgcc
aacgagaaccgctggcccgtcggcatgccgccggatgttcccgattggcgcacgttgggc
gctcccaagctcgcccgacgtgatacaccttga

DBGET integrated database retrieval system