KEGG   Mycobacterium smegmatis MC2 155: MSMEI_5779Help
Entry
MSMEI_5779        CDS       T02191                                 

Gene name
mhpF
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MSMEI_5779 (mhpF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MSMEI_5779 (mhpF)
   00650 Butanoate metabolism
    MSMEI_5779 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    MSMEI_5779 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MSMEI_5779 (mhpF)
   00622 Xylene degradation
    MSMEI_5779 (mhpF)
   00621 Dioxin degradation
    MSMEI_5779 (mhpF)
Enzymes [BR:msg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MSMEI_5779 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5999810..6000733)
Genome map
AA seq 307 aa AA seqDB search
MPKKSSVAIVGSGNISTDLLYKLLRSEWLEPRWMIGIDPESEGLARARKLGLETSAEGVD
WLLAQSEKPDLVFEATSAYVHRDAAPRYEEAGIRAIDLTPAAVGPGVVPPANLRDHLDAP
NVNMVTCGGQATIPIVHAVSRVVDVPYAEIVASVSSASAGPGTRANIDEFTKTTSAGVQN
IGGAQRGKAIIVLNPAEPPMIMRDTIFCAIPEGADHDAITQSIKDVVAEVQTYVPGYRLL
NEPQFDEPSVVNGGNHLVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKKSAEAS
LASGAQA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaaaagtcctccgtcgcgatcgtcggatccggcaacatcagcaccgatctgctc
tacaagctgctccgctcggaatggcttgagccacgctggatgatcggcatcgatccggaa
tccgaaggtttggcgcgggcacgcaaactcggcctggagacatccgccgagggagtggac
tggctgctggcacagagcgaaaagcctgatctggtcttcgaggccaccagtgcctacgtg
caccgtgacgccgcaccgcgctacgaggaagcgggcattcgtgccatcgacctcacgcct
gccgcggtgggtcctggtgtcgtcccgccggccaacctgcgcgaccacctcgacgccccg
aacgtcaacatggtcacgtgcggcggtcaggcgaccatcccgatcgtgcatgccgtaagc
cgcgtggtcgacgtgccctacgccgagatcgtcgcgtcggtgtcgtcggcgtcggcaggc
ccgggcacgcgcgccaacatcgacgagttcaccaagaccacgagcgccggcgtgcagaac
atcggcggtgcgcagcggggcaaggcgatcatcgtcctcaacccggccgaaccgccgatg
atcatgcgcgacaccatcttctgcgccatccccgaaggcgccgaccacgacgccatcacg
cagtccatcaaggacgtcgtcgccgaggtgcagacgtacgtcccgggctaccgcctgctc
aacgaaccgcagttcgacgagccttcggtggtcaacggcggcaaccatctggtcaccacg
ttcgtggaagtggagggtgcgggtgactacctgccgccctacgctggaaatctggacatc
atgaccgccgcggcgacgaaagtcggcgaggaaatcgccaagaaatcggccgaagcaagc
ctcgcgtcaggagcacaggcatga

DBGET integrated database retrieval system