KEGG   Mycobacterium smegmatis MC2 155: MSMEI_5861Help
Entry
MSMEI_5861        CDS       T02191                                 

Definition
Xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:msg00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:msg00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6087702..6088919)
Genome map
AA seq 405 aa AA seqDB search
MLESNVSTTEPLTPKREDRFSFGLWTIGWNGNDPFGVATRPALDVVEAVEKLAELGAYGL
TFHDDDLFAFGSSDTERRRMVDRLTSALSANGMVVPMVTTNLFTQPVFKDGGFTSNDRTV
RRFALRKVLRNIDLAIELGAETFVLWGGREGSEYDSAKDVQAALARYREAMDLLCQYVID
QGSGLRFAIEPKPNEPRGDILLPTVGHALAFIDTLARPEMVGVNPETGHEQMSGLNFMHG
IAQALYSGKLFHIDLNGQRGIKFDQDLVFGHGDLANAFALVDLLEHGGPDGTPAYEGPRH
FDYKPSRTEDIDGVWASAAANMRMYLLLKQRAEAFRADPAVREAMAAAKVAELRQPTLAP
GETYHDLLADRSAFEEFDSEAYFGGKGCGFVALQQLAIEHLMGAR
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
gtgttggagtcgaacgtctccacaaccgaaccgctcaccccgaagcgagaggaccgtttc
tcgttcggcctctggaccatcggctggaacggaaacgatccgttcggcgtcgccacccgc
ccggcgctcgacgtcgtggaggccgtcgagaaactggccgaactcggcgcgtacgggctg
acgttccacgatgacgacctgttcgcgttcggcagttccgacaccgagcggcggcggatg
gtcgaccggttgacgtcggcgttgtcggccaacggcatggtggtcccgatggtgacgacc
aacctgttcacccagcccgtcttcaaggacggcggtttcaccagcaacgaccgcacggtg
cggcgtttcgcgctgcgcaaggtgctgcgcaacatcgatttggccatcgaactcggcgcc
gagaccttcgtgttgtggggcggccgtgagggcagcgaatacgactcggccaaggacgtg
caggccgcgctggcgcgctaccgcgaagcgatggatctgttgtgccagtacgtgatcgac
cagggcagcgggttgcgcttcgcgatcgaacccaaacccaacgagccgcgcggcgacatc
ctgctgcccacggtggggcacgcgctggcattcatcgacaccctggcccgcccggagatg
gtcggggtgaaccccgagaccggccacgagcagatgtccggcctgaacttcatgcacggc
atcgcacaggccctgtacagcggcaagctcttccacatcgacctcaacggtcagcggggc
atcaagttcgaccaggacctcgtgttcgggcacggcgacctggccaatgccttcgcgctc
gtggatctgctcgaacacggtggtcccgacggcaccccggcgtacgagggtcctcggcac
ttcgactacaagcccagccgcaccgaggacatcgacggtgtgtgggcctcggcggccgcg
aacatgcggatgtacctgctgctcaagcagcgcgccgaggcgttccgcgccgatcccgcg
gtgcgtgaggcgatggcggcggccaaggtggccgaattgcggcagccgacgctcgcgccg
ggcgagacgtaccacgacctgttggccgaccgctcggccttcgaggagttcgacagtgag
gcctatttcggcggcaagggttgcggtttcgtcgcattgcagcagttggccatcgaacac
ctgatgggcgcgcgatga

DBGET integrated database retrieval system