KEGG   Mycobacterium smegmatis MC2 155: MSMEI_5942Help
Entry
MSMEI_5942        CDS       T02191                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:msg00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6165674..6166210)
Genome map
AA seq 178 aa AA seqDB search
MTSTVLSIGSNLGDRLTRLQSVLDGLGPAVRAVSAVYETAAWGFEEQGPFLNAVLLADDP
DLDGHGWLRRAQELEAAAGRVRGQRWGPRTLDVDLITCHDGADEIISRDEGLTLPHPLAH
LRAFVLIPWLDVDPDATLTVAGESRPVQRLLSEIDQSERDGVTRTDLVLDIRTETAAG
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgacctcaacggtgctttccatcgggtcgaatctcggggaccggctcacgcggctgcag
tcggtgctcgacggtctcgggcccgcggtgcgcgcggtctccgcggtgtacgagaccgcg
gcgtggggcttcgaagaacagggcccgttcctcaacgccgtactgctggccgacgacccg
gatctcgacgggcacgggtggctgcggcgcgcacaggaactcgaggccgcggcaggccgg
gtccgcgggcagcgctggggcccccgcacgctcgacgtcgacctgatcacgtgccacgac
ggggccgacgaaatcatctcgcgcgacgaggggctgacgctgccgcacccgctcgcgcac
ctgcgggcgtttgtgctgatcccgtggctggacgtcgacccggacgcgacgctcacggtc
gcgggcgagtcacgtccggtgcagcgcctgctgtcggagatcgaccagtccgagcgggac
ggggtcacgcgcaccgacctggtgctcgacatccggaccgaaaccgcagccggctga

DBGET integrated database retrieval system