KEGG   Mycobacterium smegmatis MC2 155: MSMEI_6068Help
Entry
MSMEI_6068        CDS       T02191                                 

Gene name
glpK
Definition
glycerol kinase GlpK (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:msg00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6293852..6295417)
Genome map
AA seq 521 aa AA seqDB search
MMDLRYGRSERPERGTVADFVAAIDQGTTSTRCMIFDHDGAEVGRHQLEHEQILPRAGWV
EHNPVEIWERTASVVMTALNRTNLQASDLAALGITNQRETSLVWNRHTGRPYYNAIVWQD
TRTDSIAAALDRDGRGDVIRRKAGLPPATYFSGGKIQWILDNVPGVREDAEKGDAIFGTA
DSWLVWNLTGGTRGGVHVTDVTNASRTMLMNLETLDWDDELLSFFGIPRRMLPEIKPSSY
PESYGITRDDGPLAGQVPLTGILGDQQAAMVGQVCLEAGEAKNTYGTGNFLLLNTGEKIV
RSDNGLLTTVCYQFGDSKPVYALEGSIAVTGSAVQWLRDQLGIISGASQSESLARQVSDN
GGVYFVPAFSGLFAPYWRSDARGAIVGLSRFNTNAHLARATLESICYQSRDVVDAMEADS
GVHLEVLKVDGGITANALCMQIQADVLGVDVVKPLVAETTALGAAYAAGLAVGFWENADD
LRANWQEDKRWSPQWSDEQREKGYAGWQKAVQRTLDWVEIE
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgatggaccttcgatacggcaggagcgagcgacccgaaaggggcacagtggccgatttc
gtcgcagcgatcgaccagggcaccacgagcacgcggtgcatgatcttcgaccatgacggc
gccgaagtgggccgccaccagctcgaacacgagcagatcctgcccagggcgggctgggtc
gagcacaacccggtggagatctgggagcgcaccgcatcggtggtgatgaccgcactcaac
cggacgaatctgcaggcctccgacctggccgcgctgggcatcaccaaccagcgcgagacg
tcgctggtgtggaaccggcacaccggcaggccctactacaacgcgatcgtgtggcaggac
acccgcaccgacagcatcgccgcggcactcgaccgtgacggccgcggtgacgtcatccgg
cgcaaggccggtctgccgcccgcgacgtacttctcgggcggcaagatccagtggatcctg
gacaacgtgccgggggtccgcgaggacgccgagaagggcgacgcgatcttcgggaccgcc
gacagttggctggtgtggaacctcaccggcggtacgcgcggcggcgtgcacgtcaccgac
gtcaccaacgccagccgcaccatgctgatgaacctggagaccctcgactgggacgacgaa
ctgttgtcgttcttcgggattccgcgccggatgctgcccgagatcaagccgtcgtcgtat
ccggagtcgtacggcatcacgcgcgacgacggtccgctggccgggcaggtgccgttgacc
ggcatcctcggtgaccagcaggccgcgatggtcggccaggtgtgcctggaggccggcgag
gccaagaacacctatggcaccggcaatttcctgctgctcaacaccggtgagaagatcgtg
cgctcggacaacggtctgctgaccacggtgtgctaccagttcggcgactcgaaaccggtt
tacgcgcttgagggttcgatcgcggtgaccggatcggccgtgcagtggttgcgcgaccag
ttgggcatcatcagcggtgcgtcgcagagcgagtcgctggcgcggcaggtcagcgacaac
ggcggcgtgtacttcgtgcccgccttctccggcctgttcgcgccgtactggcgcagcgac
gcgcgcggcgcgatcgtgggcctgtcgcggttcaacaccaacgcgcacctggcgcgtgcg
acgctggagtcgatctgctaccagagccgcgacgtggtcgacgccatggaggcggattcc
ggtgtgcaccttgaggttctcaaggtcgacggtgggatcaccgccaacgcgctgtgcatg
cagatccaggcggacgtgctcggcgtcgacgtggtcaagcccctggtcgccgagaccacc
gcgctcggtgcggcgtacgcggccggtctggcggtgggcttctgggagaacgccgacgac
ttgcgggccaactggcaggaggacaagcgctggtcaccgcagtggtcagatgagcaacgc
gagaagggatacgcgggctggcagaaggccgttcagcgcaccctcgactgggtcgagatc
gagtga

DBGET integrated database retrieval system