KEGG   Mycobacterium smegmatis MC2 155: MSMEI_6271Help
Entry
MSMEI_6271        CDS       T02191                                 

Gene name
rraA
Definition
(GenBank) Regulator of ribonuclease activity A
  KO
K02553  
regulator of ribonuclease activity A
Organism
msg  Mycobacterium smegmatis MC2 155
Brite
Messenger RNA biogenesis [BR:msg03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     MSMEI_6271 (rraA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
6506835..6507314
Genome map
AA seq 159 aa AA seqDB search
MSIEPRATADLVDEIYPDVRSCDLQLQNYGGKIMFAGPVTTVRCFQDNALLKSILSTPGE
GAVLVVDGAGSLHTALVGDVIAGLAADNGWSGVIVNGAVRDAAALRTIDVGIKALGTNPR
KGTKTGEGERDVEVSFGGVTFTPGDIAYCDEDGIVVVTP
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
gtgagtatcgaaccgcgcgccaccgccgacctcgtcgacgagatctatcccgacgtccgc
agctgtgacctgcaattgcagaactacggcggcaagatcatgttcgcaggcccggtcacc
acggtgcgctgcttccaggacaacgcgctgctgaagtcgatcctctcgacgccgggtgag
ggcgcggtgctcgtggtcgacggcgccggttccctgcacaccgcgctcgtcggcgacgtc
atcgccggtctggcggccgacaacggctggtccggtgtgatcgtcaacggtgcggtgcgc
gacgccgccgcgctgcgcaccatcgacgtcggtatcaaggcactcggcaccaacccccgc
aagggcaccaagaccggcgagggcgagcgcgatgtcgaggtcagcttcggcggcgtgacc
ttcacccccggcgacatcgcctactgcgacgaggacggcatcgtcgtcgttaccccctga

DBGET integrated database retrieval system