KEGG   Mycobacterium smegmatis MC2 155: MSMEI_6334Help
Entry
MSMEI_6334        CDS       T02191                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    MSMEI_6334 (pncA)
Enzymes [BR:msg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     MSMEI_6334 (pncA)
    3.5.1.-  
     MSMEI_6334 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6568637..6569188
Genome map
AA seq 183 aa AA seqDB search
MRALIVVDVQNDFCEGGSLAVTGGAAVARGITELLAGDHGYDHVVATMDFHIDPGEHFSD
TPDYQVSWPRHCVADTPGAEFHPEFDAGAVEVVFRKGHYSAAYSGFEGTDESGTTLADWL
RERDVDAVDVVGIATDYCVAATAADAAGAGFATRVLTRLTAGVAPESTTAAVDQLRSAGV
TIS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcactgattgtcgtcgacgtccagaacgatttctgcgagggcggttcgctggcg
gtcaccggtggtgcggcagtggcccgcgggatcaccgaactgctggccggtgatcatggt
tacgaccatgtggtcgccacaatggatttccacatcgacccgggtgagcacttctcggac
acacccgactaccaggtgtcgtggccgcgccactgcgtggccgacaccccgggcgccgag
ttccatccggagttcgatgcaggtgcggtggaggtggtgttccgcaagggccactactcg
gcggcctacagcggcttcgagggcaccgacgaatcggggacgacgctggccgactggctg
cgcgagcgggatgtcgacgcggtcgacgtcgtcggcatcgccaccgactactgcgtggcc
gccacggccgccgacgccgcgggcgccggtttcgccacccgcgtgctcacgcggctgacg
gccggggtcgcgcccgagagcacgacggcggcggtcgaccaattgcgttctgccggagtg
acgatcagctga

DBGET integrated database retrieval system