KEGG   Mycobacterium smegmatis MC2 155: MSMEI_6570Help
Entry
MSMEI_6570        CDS       T02191                                 

Gene name
celA
Definition
cellulase celA1 (endoglucanase) (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:msg00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6797905..6798894)
Genome map
AA seq 329 aa AA seqDB search
MKSSAARTATRWIAPFLAVTALAGAGALAEPVRPGAAIEVRLASDGNPLAGQTFYVDPNS
KAMRALKGNPSPELEMIANTPHAYWMDNVSTFAVDAKYIQTAQAAGTMPILALYGIPNRD
CGSLAAGGFGSAAAYRGWIDGVAGAIGSGPAAVILEPDALAMADCLSPDQRQERFDLIRY
AVDTLTRNPATAVYVDAGHSRWVNAEDMAARLNEVGVTKTRGFSLNTANFFTTEEEIGYG
EAISGLTNGSHYVIDTSRNGVGPVDSDSWCNPPGRALGSPPTTATAGAHADAYLWVKRPG
ESDGACNGHPSAGTFVSQYAIDLARNAGR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcctcagctgcacgtacagccacgcgatggatcgctcccttcttggccgtgacg
gccctggccggcgccggtgcgctcgccgaaccggtgcgcccgggtgccgcgatcgaggta
cgcctcgccagcgacgggaacccgctcgccgggcagacgttctatgtcgacccgaactcc
aaggcgatgcgcgcgctgaagggcaatcccagccccgagctggagatgatcgcgaacacg
ccgcacgcgtactggatggacaacgtgtcgacgttcgcggtcgacgccaagtacatccag
acggcgcaggccgcgggcaccatgccgatcctggcgttgtacggcatcccgaaccgtgac
tgcggcagcctcgcggcgggcggcttcggctcggcggcggcctaccggggatggatcgac
ggcgtcgccggtgcgatcggctcgggtccggccgcggtgatcctcgaacccgacgcgctc
gcgatggccgactgcctgtcgcccgaccagcgccaggaacgtttcgacctgatccgctac
gcggtcgacacgctgacccgcaaccccgccaccgcggtgtacgtcgacgccgggcactcg
cgctgggtcaacgccgaggacatggccgcccggctcaacgaggtcggcgtcaccaaaacg
cgcggattcagcctcaacaccgccaacttcttcaccaccgaggaagagatcggctacggc
gaggccatctccgggctcaccaacggttcgcactacgtcatcgacacgtcgcgcaacggc
gtcggacccgtcgacagcgactcgtggtgcaacccgcccggacgtgcgctggggtcgcct
ccgaccaccgcgaccgcgggcgcccacgccgatgcctacctgtgggtgaagaggcccggc
gaatccgacggtgcctgcaacgggcatccctcggcgggcacgttcgtcagccagtacgcg
atcgacctcgcacgcaacgccggacgctga

DBGET integrated database retrieval system