KEGG   Mycobacterium smegmatis MC2 155: MSMEI_6603Help
Entry
MSMEI_6603        CDS       T02191                                 

Definition
(RefSeq) Triosephosphate isomerase 2 (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MSMEI_6603
   01230 Biosynthesis of amino acids
    MSMEI_6603
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSMEI_6603
   00051 Fructose and mannose metabolism
    MSMEI_6603
   00562 Inositol phosphate metabolism
    MSMEI_6603
Enzymes [BR:msg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MSMEI_6603
Exosome [BR:msg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MSMEI_6603
  Exosomal proteins of bladder cancer cells
   MSMEI_6603
  Exosomal proteins of melanoma cells
   MSMEI_6603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6835577..6836389)
Genome map
AA seq 270 aa AA seqDB search
MTSARTRVPDARALGAAQLWIGTSWKMNKGLAESRGYARELAEYVAAKPPAGVQPFIIPS
FTALTTVRDALGDDSPVLLGVQNAHWEDHGAWTGEVSVAQAKDAGAQIVEIGHSERREHF
GETVETTRLKVAAALHHGLVPLLCIGESAENKQAGESSRFILEQAAGALEGLTDEHLARV
LIAYEPIWAIGENGRPATVEELRQPFDDLAREYGCRTMGLLYGGSVNTDNAEDLLGIDHV
TGLFIGRAAWQLPGYVRILEMAAAHPKAKA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgacatctgcgcgtacgagggtgcctgacgctcgggcgctcggcgccgcacagctgtgg
atcggcaccagctggaagatgaacaaggggctcgccgagtcgcgtggttacgcccgcgaa
ctggccgagtacgtcgcggcgaagccgccggccggcgtccagccgttcatcatcccgtcg
ttcaccgcactcaccacggtgcgggacgcgctgggcgacgactcgcccgtgctgctcggg
gtgcagaacgcacactgggaggaccacggcgcatggaccggtgaggtctccgtcgcgcag
gcgaaggacgcaggcgcgcagatcgtcgagatcgggcactccgagcgtcgtgagcatttc
ggtgagaccgtcgagaccacacggctcaaggtggccgcggcgctgcatcacggtctggtg
ccgctgctgtgcatcggcgagagcgccgagaacaagcaggccggtgagtcgtcgcgcttc
atcctcgagcaggccgcaggcgccctggagggtttgaccgacgagcatttggcccgcgtt
ctcattgcctacgagcccatctgggcgatcggcgagaacggtcgcccggcgaccgtcgag
gaactgcggcagccgttcgatgatctggcacgcgaatacggttgtcgcacaatgggattg
ctctacggtgggtcggtgaacaccgacaacgccgaagatctgctgggcatcgatcacgtc
acggggttgttcatcggacgggcggcctggcagttgcccggttacgtgcggatccttgag
atggccgcggctcaccccaaggccaaggcctga

DBGET integrated database retrieval system