KEGG   Mycobacterium smegmatis MC2 155: MSMEI_6603Help
Entry
MSMEI_6603        CDS       T02191                                 

Definition
(GenBank) Triosephosphate isomerase 2
  KO
K20905  
L-erythrulose 4-phosphate epimerase [EC:5.1.3.39]
Organism
msg  Mycobacterium smegmatis MC2 155
Brite
Enzymes [BR:msg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.39  L-erythrulose 4-phosphate epimerase
     MSMEI_6603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(6835577..6836389)
Genome map
AA seq 270 aa AA seqDB search
MTSARTRVPDARALGAAQLWIGTSWKMNKGLAESRGYARELAEYVAAKPPAGVQPFIIPS
FTALTTVRDALGDDSPVLLGVQNAHWEDHGAWTGEVSVAQAKDAGAQIVEIGHSERREHF
GETVETTRLKVAAALHHGLVPLLCIGESAENKQAGESSRFILEQAAGALEGLTDEHLARV
LIAYEPIWAIGENGRPATVEELRQPFDDLAREYGCRTMGLLYGGSVNTDNAEDLLGIDHV
TGLFIGRAAWQLPGYVRILEMAAAHPKAKA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgacatctgcgcgtacgagggtgcctgacgctcgggcgctcggcgccgcacagctgtgg
atcggcaccagctggaagatgaacaaggggctcgccgagtcgcgtggttacgcccgcgaa
ctggccgagtacgtcgcggcgaagccgccggccggcgtccagccgttcatcatcccgtcg
ttcaccgcactcaccacggtgcgggacgcgctgggcgacgactcgcccgtgctgctcggg
gtgcagaacgcacactgggaggaccacggcgcatggaccggtgaggtctccgtcgcgcag
gcgaaggacgcaggcgcgcagatcgtcgagatcgggcactccgagcgtcgtgagcatttc
ggtgagaccgtcgagaccacacggctcaaggtggccgcggcgctgcatcacggtctggtg
ccgctgctgtgcatcggcgagagcgccgagaacaagcaggccggtgagtcgtcgcgcttc
atcctcgagcaggccgcaggcgccctggagggtttgaccgacgagcatttggcccgcgtt
ctcattgcctacgagcccatctgggcgatcggcgagaacggtcgcccggcgaccgtcgag
gaactgcggcagccgttcgatgatctggcacgcgaatacggttgtcgcacaatgggattg
ctctacggtgggtcggtgaacaccgacaacgccgaagatctgctgggcatcgatcacgtc
acggggttgttcatcggacgggcggcctggcagttgcccggttacgtgcggatccttgag
atggccgcggctcaccccaaggccaaggcctga

DBGET integrated database retrieval system