KEGG   Methanobrevibacter smithii: Msm_0134Help
Entry
Msm_0134          CDS       T00539                                 

Definition
M42 glutamyl aminopeptidase/endo-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
msi  Methanobrevibacter smithii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Msm_0134
Enzymes [BR:msi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Msm_0134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(128536..129567)
Genome map
AA seq 343 aa AA seqDB search
MMELMKELSLTPGVSGSEEKIANIIKRELKDVADSIEEDSMGNVIATKKGEKKAPTVMLA
SHMDEIGLMVRYIDEKGYVKFSTIGGINDQMLMNQSVIIHSSIGEDVPGVIGSKPPHVTK
PEERNKVVKADDMFIDIGAKDQEDAEKMIRIGDKISFRAWFEEYPNDLIMGKALDNRVGC
YVMMEVLKRVNTRATVYGVGTVQEEVGLKGAKTSAFKLNPDMAIALDVTLSGDHPGIKPE
EAPVVMGKGPAIILADASGRGILTQQSIKDLLIKAGDENEIDYQLEVSDGGTTDGTAIHL
TREGIPTGVLSVPTRYIHTTVSVCSMKDVESTIQLITEAINSL
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgatggaattaatgaaagagctatctttaactccaggtgtttctggatctgaagaaaaa
atagcaaacattattaaaagagaattaaaagatgtcgctgattctattgaagaagacagt
atgggtaatgtaatagctactaaaaaaggtgagaaaaaagcacctactgtaatgttagct
tcccatatggatgaaatcggattgatggtcagatatattgatgaaaaaggatatgtcaaa
ttctcaacaattggtggaattaatgaccaaatgttaatgaatcagtctgtaattattcac
agcagcattggagaagatgttccgggggttattggctcaaaaccacctcatgttacaaaa
cctgaagaaagaaacaaagttgtaaaagcagatgacatgtttattgatatcggtgcaaaa
gaccaggaagatgcagaaaaaatgattcgtattggagacaaaataagtttcagagcttgg
tttgaagaatatccaaacgatttgattatgggtaaagcattagataatcgtgttggctgt
tatgtaatgatggaagttttaaaaagagtaaatacaagagctactgtttacggtgtaggt
actgtacaggaagaagtaggtcttaaaggagcaaaaacttctgcatttaaattaaatcca
gacatggctattgcattagatgttaccttatctggtgaccatccgggaattaaacctgaa
gaggcaccagtagtaatgggtaaaggtccggctataattttagctgatgcaagtggacgc
ggaattcttactcagcagtcaattaaagacttgcttattaaagcaggtgatgaaaatgaa
attgattaccagcttgaagtaagtgacggcggaacaactgacggtacagctattcactta
acaagggaaggaattccaactggagttttatcagttccaaccagatatatacacactact
gtaagtgtttgcagtatgaaagatgttgaatcaactattcaattaattacagaagctata
aattcattatag

DBGET integrated database retrieval system