KEGG   Methanobrevibacter smithii ATCC 35061: Msm_0134Help
Entry
Msm_0134          CDS       T00539                                 

Definition
M42 glutamyl aminopeptidase/endo-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
msi  Methanobrevibacter smithii ATCC 35061
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:msi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(128536..129567)
Genome map
AA seq 343 aa AA seqDB search
MMELMKELSLTPGVSGSEEKIANIIKRELKDVADSIEEDSMGNVIATKKGEKKAPTVMLA
SHMDEIGLMVRYIDEKGYVKFSTIGGINDQMLMNQSVIIHSSIGEDVPGVIGSKPPHVTK
PEERNKVVKADDMFIDIGAKDQEDAEKMIRIGDKISFRAWFEEYPNDLIMGKALDNRVGC
YVMMEVLKRVNTRATVYGVGTVQEEVGLKGAKTSAFKLNPDMAIALDVTLSGDHPGIKPE
EAPVVMGKGPAIILADASGRGILTQQSIKDLLIKAGDENEIDYQLEVSDGGTTDGTAIHL
TREGIPTGVLSVPTRYIHTTVSVCSMKDVESTIQLITEAINSL
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgatggaattaatgaaagagctatctttaactccaggtgtttctggatctgaagaaaaa
atagcaaacattattaaaagagaattaaaagatgtcgctgattctattgaagaagacagt
atgggtaatgtaatagctactaaaaaaggtgagaaaaaagcacctactgtaatgttagct
tcccatatggatgaaatcggattgatggtcagatatattgatgaaaaaggatatgtcaaa
ttctcaacaattggtggaattaatgaccaaatgttaatgaatcagtctgtaattattcac
agcagcattggagaagatgttccgggggttattggctcaaaaccacctcatgttacaaaa
cctgaagaaagaaacaaagttgtaaaagcagatgacatgtttattgatatcggtgcaaaa
gaccaggaagatgcagaaaaaatgattcgtattggagacaaaataagtttcagagcttgg
tttgaagaatatccaaacgatttgattatgggtaaagcattagataatcgtgttggctgt
tatgtaatgatggaagttttaaaaagagtaaatacaagagctactgtttacggtgtaggt
actgtacaggaagaagtaggtcttaaaggagcaaaaacttctgcatttaaattaaatcca
gacatggctattgcattagatgttaccttatctggtgaccatccgggaattaaacctgaa
gaggcaccagtagtaatgggtaaaggtccggctataattttagctgatgcaagtggacgc
ggaattcttactcagcagtcaattaaagacttgcttattaaagcaggtgatgaaaatgaa
attgattaccagcttgaagtaagtgacggcggaacaactgacggtacagctattcactta
acaagggaaggaattccaactggagttttatcagttccaaccagatatatacacactact
gtaagtgtttgcagtatgaaagatgttgaatcaactattcaattaattacagaagctata
aattcattatag

DBGET integrated database retrieval system