KEGG   Methanobrevibacter smithii: Msm_0214Help
Entry
Msm_0214          CDS       T00539                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
msi  Methanobrevibacter smithii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Msm_0214
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Msm_0214
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Msm_0214
Enzymes [BR:msi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Msm_0214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(200420..201616)
Genome map
AA seq 398 aa AA seqDB search
MIRCVSCGEEYDNDEIIYTCEKCGSVLELVSDFDVSKDIFDGRKDTLWKFKECIPVDESK
IVSLNEGGTPFCKCDKLGDELGINLYVKVEGSNPTGSFKDRGMTVGMTKAMELGVHTVGC
ASTGNTSASLAAYAARAGLRCIVFLPSGKVALGKLAQAMFHGAEVMSINGNFDEALEAMT
ALALEKHLYLLNSINPYRLEGQKTIGYEILRDLGWQSPDRIILPVGNAGNISAIWKGVKE
FYEAGFVDSVPMMTGIQAEGACPVTNAFKKHADRVVPVENPETIATAIRIGAPVSDIKAL
RAIYESDGYSETVSDEEILDAQKLLARKEGIGVEPASAASIAGLKKLCDEGVVDNGETVT
CVVTGHLLKDPNTAIDACTKPKQVDADIDTLRKILMNK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgattagatgtgtttcatgcggagaagaatatgataatgatgagataatttacacttgt
gaaaaatgtggatctgttctcgaacttgttagtgattttgatgtttctaaagatatcttt
gacggcagaaaagatactttatggaaatttaaagaatgcatacctgttgatgaatctaaa
attgtttcactcaacgaaggtggaactccattttgcaaatgcgacaaattgggggatgaa
ttaggtatcaatttatatgttaaagttgaagggtcaaatccgacaggaagtttcaaggac
aggggaatgactgttggtatgaccaaagctatggaacttggagttcatactgttggctgt
gcttcaacaggaaatacatcagcatctcttgcagcatatgcagctagagcaggtttacgt
tgtattgtatttttaccttccggaaaagtagctttaggaaaattggcacaggctatgttc
cacggtgctgaagtaatgtccattaacggaaactttgatgaagcacttgaagctatgact
gctcttgcattagaaaaacatctttacttattaaactcaattaacccttacagattagaa
ggtcaaaaaacaatcggatatgaaatattaagggatttaggatggcaatctccagacagg
attattctgcctgttggaaatgcaggaaatatttcagctatctggaaaggtgttaaagag
ttttacgaagcaggttttgtagatagtgtacctatgatgaccggaattcaggctgaaggt
gcatgtccagttacaaatgcatttaaaaaacatgctgatagggttgttccagtagaaaat
ccggaaacaatagctactgcaattcgtataggtgctcctgtaagtgacattaaagcttta
agggctatttatgagtctgacggatattctgaaactgtaagtgatgaagagatattggat
gctcaaaaattattagctagaaaagagggaataggtgttgaaccggcttctgcagcttca
attgcaggtcttaaaaaattatgtgacgaaggagttgtagataatggagaaactgtaacc
tgtgttgttaccggtcatttacttaaagatccgaatactgcaattgatgcatgtactaaa
ccaaaacaagtggatgcagatattgacactttaagaaaaattttaatgaataaatag

DBGET integrated database retrieval system