KEGG   Methanobrevibacter smithii: Msm_0330Help
Entry
Msm_0330          CDS       T00539                                 

Definition
acetyl-CoA synthetase, AMP-forming-related, Acs (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
msi  Methanobrevibacter smithii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:msi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Msm_0330
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msm_0330
   00620 Pyruvate metabolism
    Msm_0330
   00640 Propanoate metabolism
    Msm_0330
  Energy metabolism
   00680 Methane metabolism
    Msm_0330
Enzymes [BR:msi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Msm_0330
Lipid biosynthesis proteins [BR:msi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Msm_0330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
311157..312827
Genome map
AA seq 556 aa AA seqDB search
MTSLIEDYVNRVDFDSYEDFHKNFKITYPDNFNFGFDVIDKYAEIDPEKIALIWTNDEDE
KHTFTFSDVKKYSNKIANFFTKKGIKKGDKVMLTLKNRYEFWFTMVALHKIGAVAIPATH
MLKLHDIDFRIKNANVKLIVTVEEDRLIPDYEEAQKELGTDLVKCVIERDLDGWINFNKA
IEEESDEFERPTGDDEVLADDISLIYFTSGTSGLPKMVAHKQTYGLGHIPTAKYWHKVEE
DGIHHTAADTGWGKAVWGNFYGQWIAGSAVFIYDYDRFNGIKLLEKVIENKVNTFCAPPT
IYRFLIKENIKGYDFSNIHHVTTAGEPLPPEVSKRFKEISGLRIKEGFGQTETVLTIATF
DWIDAKLGSIGKPSPLFDVKLLNENDEEVDIGQEGEICIDVSHGISPGLFKEYYKNPEKQ
AAQWHDGYYHCGDTAWKDEDGYIHFIGRNDDIIKSSGYRIGPYEVESAVLSHESVSNCAI
TAYPDEIRGQIVKATIILQPGYEGSEELKKEIQNHVKRVTAPYKYPRLIEFVDEIPETIS
GKIRRVEIRNNDNKKE
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgacatcattaattgaagattatgtaaatagagttgattttgactcatatgaagatttt
cacaaaaattttaaaataacatatcctgacaattttaatttcgggtttgatgtaatcgac
aaatatgctgaaatagaccctgaaaaaatcgctttaatctggacaaacgatgaagatgaa
aaacacactttcaccttttcagatgttaaaaagtatagtaataaaattgcaaactttttt
actaaaaaaggcattaaaaaaggtgataaagtaatgcttaccttaaaaaacagatacgaa
ttctggtttaccatggttgcattgcataaaatcggagcagtagctattcctgcaacccac
atgttaaaacttcatgatattgatttcaggataaaaaatgccaatgtcaaacttatcgta
actgttgaagaagacagattaattccagattatgaagaagctcaaaaggaacttggcact
gatttggtaaaatgtgtaattgaaagggatcttgacggctggattaattttaataaagct
atcgaagaggaaagcgatgaatttgaaagaccgaccggagacgatgaagtgcttgcagat
gacatttcattaatttatttcacatcaggtacaagcggacttcctaaaatggtagctcac
aaacaaacttacggattaggacacattccaacagctaaatattggcataaagtagaagaa
gacggtatacaccacacagcagcagataccggatggggaaaagcagtctggggaaacttc
tacggacaatggattgcaggatctgcagttttcatatatgattacgacagattcaacggt
attaaattacttgaaaaagttattgaaaataaagtaaacactttctgtgctcctccaaca
atatacagattcttaattaaagaaaacatcaaaggatatgacttttcaaacatacatcat
gtaacaacagctggagaaccattacctcctgaagtatcaaaaaggtttaaagaaatatcc
ggactgagaattaaggaaggattcggtcaaaccgaaacagtattgactattgcaactttt
gactggatagatgcaaaattaggttctatcggaaaaccaagcccgttatttgatgttaaa
ttattaaatgaaaatgatgaagaagttgacataggtcaggaaggtgaaatctgtattgat
gtatctcatggcataagtcctggtttatttaaagaatattacaaaaatcctgaaaaacag
gctgcacaatggcatgacggctactaccattgcggagataccgcatggaaggacgaagac
ggatatatccatttcataggaagaaatgatgatattattaaaagttcaggataccgtatt
ggaccttatgaagtagaaagtgcagtattatcccatgaatcagtaagtaactgtgcaatt
actgcatatcctgatgaaataagaggacaaatcgtaaaagctacaatcatattgcaacca
ggatacgaaggttccgaagaacttaaaaaagaaattcaaaatcatgtaaaaagagttaca
gctccttataaatatccaagattaattgaatttgtggatgaaattccagaaacaataagt
ggaaaaataagaagagtagaaatcagaaataacgataacaaaaaggaatag

DBGET integrated database retrieval system