KEGG   Methanobrevibacter smithii: Msm_0330Help
Entry
Msm_0330          CDS       T00539                                 

Definition
(RefSeq) acetyl-CoA synthetase, AMP-forming-related, Acs (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
msi  Methanobrevibacter smithii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:msi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Msm_0330
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msm_0330
   00620 Pyruvate metabolism
    Msm_0330
   00640 Propanoate metabolism
    Msm_0330
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Msm_0330
   00680 Methane metabolism
    Msm_0330
Enzymes [BR:msi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Msm_0330
Lipid biosynthesis proteins [BR:msi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Msm_0330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
311157..312827
Genome map
AA seq 556 aa AA seqDB search
MTSLIEDYVNRVDFDSYEDFHKNFKITYPDNFNFGFDVIDKYAEIDPEKIALIWTNDEDE
KHTFTFSDVKKYSNKIANFFTKKGIKKGDKVMLTLKNRYEFWFTMVALHKIGAVAIPATH
MLKLHDIDFRIKNANVKLIVTVEEDRLIPDYEEAQKELGTDLVKCVIERDLDGWINFNKA
IEEESDEFERPTGDDEVLADDISLIYFTSGTSGLPKMVAHKQTYGLGHIPTAKYWHKVEE
DGIHHTAADTGWGKAVWGNFYGQWIAGSAVFIYDYDRFNGIKLLEKVIENKVNTFCAPPT
IYRFLIKENIKGYDFSNIHHVTTAGEPLPPEVSKRFKEISGLRIKEGFGQTETVLTIATF
DWIDAKLGSIGKPSPLFDVKLLNENDEEVDIGQEGEICIDVSHGISPGLFKEYYKNPEKQ
AAQWHDGYYHCGDTAWKDEDGYIHFIGRNDDIIKSSGYRIGPYEVESAVLSHESVSNCAI
TAYPDEIRGQIVKATIILQPGYEGSEELKKEIQNHVKRVTAPYKYPRLIEFVDEIPETIS
GKIRRVEIRNNDNKKE
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgacatcattaattgaagattatgtaaatagagttgattttgactcatatgaagatttt
cacaaaaattttaaaataacatatcctgacaattttaatttcgggtttgatgtaatcgac
aaatatgctgaaatagaccctgaaaaaatcgctttaatctggacaaacgatgaagatgaa
aaacacactttcaccttttcagatgttaaaaagtatagtaataaaattgcaaactttttt
actaaaaaaggcattaaaaaaggtgataaagtaatgcttaccttaaaaaacagatacgaa
ttctggtttaccatggttgcattgcataaaatcggagcagtagctattcctgcaacccac
atgttaaaacttcatgatattgatttcaggataaaaaatgccaatgtcaaacttatcgta
actgttgaagaagacagattaattccagattatgaagaagctcaaaaggaacttggcact
gatttggtaaaatgtgtaattgaaagggatcttgacggctggattaattttaataaagct
atcgaagaggaaagcgatgaatttgaaagaccgaccggagacgatgaagtgcttgcagat
gacatttcattaatttatttcacatcaggtacaagcggacttcctaaaatggtagctcac
aaacaaacttacggattaggacacattccaacagctaaatattggcataaagtagaagaa
gacggtatacaccacacagcagcagataccggatggggaaaagcagtctggggaaacttc
tacggacaatggattgcaggatctgcagttttcatatatgattacgacagattcaacggt
attaaattacttgaaaaagttattgaaaataaagtaaacactttctgtgctcctccaaca
atatacagattcttaattaaagaaaacatcaaaggatatgacttttcaaacatacatcat
gtaacaacagctggagaaccattacctcctgaagtatcaaaaaggtttaaagaaatatcc
ggactgagaattaaggaaggattcggtcaaaccgaaacagtattgactattgcaactttt
gactggatagatgcaaaattaggttctatcggaaaaccaagcccgttatttgatgttaaa
ttattaaatgaaaatgatgaagaagttgacataggtcaggaaggtgaaatctgtattgat
gtatctcatggcataagtcctggtttatttaaagaatattacaaaaatcctgaaaaacag
gctgcacaatggcatgacggctactaccattgcggagataccgcatggaaggacgaagac
ggatatatccatttcataggaagaaatgatgatattattaaaagttcaggataccgtatt
ggaccttatgaagtagaaagtgcagtattatcccatgaatcagtaagtaactgtgcaatt
actgcatatcctgatgaaataagaggacaaatcgtaaaagctacaatcatattgcaacca
ggatacgaaggttccgaagaacttaaaaaagaaattcaaaatcatgtaaaaagagttaca
gctccttataaatatccaagattaattgaatttgtggatgaaattccagaaacaataagt
ggaaaaataagaagagtagaaatcagaaataacgataacaaaaaggaatag

DBGET integrated database retrieval system