KEGG   Methanobrevibacter smithii: Msm_0557Help
Entry
Msm_0557          CDS       T00539                                 

Definition
pyruvate:ferredoxin oxidoreductase, gamma subunit, PorG (EC:1.2.7.1)
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
msi  Methanobrevibacter smithii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:msi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Msm_0557
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msm_0557
   00020 Citrate cycle (TCA cycle)
    Msm_0557
   00620 Pyruvate metabolism
    Msm_0557
   00640 Propanoate metabolism
    Msm_0557
   00650 Butanoate metabolism
    Msm_0557
  Energy metabolism
   00680 Methane metabolism
    Msm_0557
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Msm_0557
Enzymes [BR:msi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Msm_0557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
536208..536732
Genome map
AA seq 174 aa AA seqDB search
MIEIRFHGRGGQGSVTAAEILAKAAFKDGKYVQSFPFFGVERRGAPVMAFTRIDDKPIDI
RYQVYNPDYVLVLDDGLMNVVDVFSGIKENTEVIINIAEEFKGSGEHPVHSIDATGIALD
LLGRNIVNTIILGYFAKKTNVVSIESLIEVIKETFPGKVGELNAEATKKAYDMG
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaattcgttttcacggacgtggtggacaagggtccgtaactgctgctgaaatt
ttagcgaaggctgcttttaaagatggtaaatacgttcaatccttccctttctttggagtt
gaacgtaggggagcaccagtaatggcttttactagaattgatgacaaaccaattgacata
agataccaagtatacaatccagactatgtattagttcttgatgatggattaatgaatgtg
gtggatgtattttctggaataaaagaaaatactgaagtaattatcaatattgctgaagaa
tttaaaggttcaggtgaacacccagttcatagcattgatgcaaccggaatagcattagat
ttattaggacgtaatattgtcaacacaattatcttaggatactttgctaaaaaaaccaat
gtcgtaagtattgaatcacttattgaagtaattaaagaaacattccctggaaaagttggg
gaattaaatgcagaagctacaaaaaaggcttatgacatgggataa

DBGET integrated database retrieval system